Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: Tshz2Sample Type: Mouse Liver lysatesAntibody Dilution: 1.0ug/ml)

Rabbit TSHZ3 Polyclonal Antibody | anti-TSHZ3 antibody

TSHZ3 Antibody - middle region

Gene Names
TSHZ3; TSH3; ZNF537
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TSHZ3; Polyclonal Antibody; TSHZ3 Antibody - middle region; anti-TSHZ3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VARHYLFENTDQPIDLTKSKSKRAESSQAQSCTSPPQKHALCDIADMVKV
Sequence Length
384
Applicable Applications for anti-TSHZ3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse TSHZ3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: Tshz2Sample Type: Mouse Liver lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: Tshz2Sample Type: Mouse Liver lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-TSHZ3 antibody
This is a rabbit polyclonal antibody against Tshz2. It was validated on Western Blot
Product Categories/Family for anti-TSHZ3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
teashirt homolog 3
NCBI Official Synonym Full Names
teashirt zinc finger homeobox 3
NCBI Official Symbol
TSHZ3
NCBI Official Synonym Symbols
TSH3; ZNF537
NCBI Protein Information
teashirt homolog 3
UniProt Protein Name
Teashirt homolog 3
Protein Family
UniProt Gene Name
TSHZ3
UniProt Synonym Gene Names
KIAA1474; TSH3; ZNF537
UniProt Entry Name
TSH3_HUMAN

NCBI Description

This gene encodes a zinc-finger transcription factor that regulates smooth muscle cell differentiation in the developing urinary tract. Consistent with this role, mice in which this gene has been inactivated exhibit abnormal gene expression in urinary tract smooth muscle cell precursors and kidney defects including hydronephrosis. The encoded transcription factor comprises a gene silencing complex that inhibits caspase expression. Reduced expression of this gene and consequent caspase upregulation may be correlated with progression of Alzheimer's disease in human patients. [provided by RefSeq, Jul 2016]

Uniprot Description

TSHZ3: Transcriptional regulator involved in developmental processes. Function in association with APBB1, SET and HDAC factors as a transcriptional repressor, that inhibits the expression of CASP4. TSHZ3-mediated transcription repression involves the recruitment of histone deacetylases HDAC1 and HDAC2. Associates with chromatin in a region surrounding the CASP4 transcriptional start site(s). Regulates the development of neurons involved in both respiratory rhythm and airflow control. Promotes maintenance of nucleus ambiguus (nA) motoneurons, which govern upper airway function, and establishes a respiratory rhythm generator (RRG) activity compatible with survival at birth. Involved in the differentiation of the proximal uretic smooth muscle cells during developmental processes. Involved in the up- regulation of myocardin, that directs the expression of smooth muscle cells in the proximal ureter. Belongs to the teashirt C2H2-type zinc-finger protein family.

Protein type: C2H2-type zinc finger protein; Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 19q12

Cellular Component: nucleoplasm; growth cone; mitochondrion; nucleus

Molecular Function: protein binding; DNA binding; metal ion binding; chromatin binding

Biological Process: transcription, DNA-dependent; sensory perception of touch; in utero embryonic development; ureteric bud development; positive regulation of smooth muscle cell differentiation; neurological control of breathing; musculoskeletal movement; negative regulation of transcription, DNA-dependent; metanephros development; lung development

Research Articles on TSHZ3

Similar Products

Product Notes

The TSHZ3 tshz3 (Catalog #AAA3201097) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TSHZ3 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TSHZ3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TSHZ3 tshz3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VARHYLFENT DQPIDLTKSK SKRAESSQAQ SCTSPPQKHA LCDIADMVKV. It is sometimes possible for the material contained within the vial of "TSHZ3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.