Mouse anti-Human ZNF461 Polyclonal Antibody | anti-ZNF461 antibody

ZNF461 (Zinc Finger Protein 461, Gonadotropin-inducible Ovary Transcription Repressor 1, GIOT1, GIOT-1)

Cat. Num. AAA647271

• Gene Names: ZNF461; GIOT1; GIOT-1
• Reactivity: Human
• Applications: Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: ZNF461; Polyclonal Antibody; ZNF461 (Zinc Finger Protein 461; Gonadotropin-inducible Ovary Transcription Repressor 1; GIOT1; GIOT-1); Anti -ZNF461 (Zinc Finger Protein 461; anti-ZNF461 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human ZNF461.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MAHELVMFRDVAIDVSQEEWECLNPAQRNLYKEVMLENYSNLVSLGLSVSKPAVISSLEQGKEPWMVVREETGRWCPGTWKTWGFHNNFLDNNEATDINADLASRDEPQKLSPKRDIYETELSQWVNMEEFKSHSPERSIFSAIWEGNCHFEQHQGQEEGYFRQLMINHENMPIFSQHTLLTQEFYDREKISECKKCRKIFSYHLFFSHHKRTHSKELSECKECTEIVNTPCLFKQQTIQNGDKCNECKECWKAFVHCSQLKHLRIHNGEKRYECNECGKAFNYGSELTLHQRIHTGEKPYECKECGKAFRQRSQLTQHQRLHTGEKPYECKQCGKAFIRGFQLTEHLRLHTGEKPYECKECGKTFRHRSHLTIHQRIHTGEKPYECRECGKAFSYHSSFSHHQKIHSGKKPYECHECGKAFCDGLQLTLHQRIHTGEKPYECKECGKTFRQCSHLKRHQRIHTGEKPHECMICGKAFRLHSHLIQHQRIHTGEKPYECKECGKAFSYHSSFSHHQRIHSGKKPYQCGKAFNHRLQLNLHQTLHTGEKPVRFPLLPPHPSLAS

• Applicable Applications for anti-ZNF461 antibody: Western Blot (WB), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence and Western Blot.; Dilution: Immunofluorescence: 10ug/ml
• Immunogen: Full length human ZNF461, aa1-563 (NP_694989.2).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(GIOT-1 M polyclonal antibody. Western Blot analysis of GIOT-1 expression in human liver.)

Western Blot (WB)

(ZNF461 polyclonal antibody. Western Blot analysis of ZNF461 expression in Jurkat.)

Western Blot (WB)

(Western Blot analysis of ZNF461 expression in transfected 293T cell line by ZNF461 polyclonal antibody. Lane 1: GIOT-1 transfected lysate (61.93kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to ZNF461 on HepG2 cell. [antibody concentration 10ug/ml].)

Product Categories/Family for anti-ZNF461 antibody

Antibodies; Abs to Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 46371195
• NCBI GeneID: 92283
• NCBI Accession #: NP_694989.2
• NCBI GenBank Nucleotide #: NM_153257.2
• UniProt Accession #: Q8TAF7; Q6VSF7; Q9ULZ8; A8K9W9
• Molecular Weight: 66,214 Da
• NCBI Official Full Name: zinc finger protein 461
• NCBI Official Synonym Full Names: zinc finger protein 461
• NCBI Official Symbol: ZNF461
• NCBI Official Synonym Symbols: GIOT1; GIOT-1
• NCBI Protein Information: zinc finger protein 461; gonadotropin inducible transcription repressor 1; gonadotropin-inducible ovary transcription repressor 1
• UniProt Protein Name: Zinc finger protein 461
• Protein Family: Zinc finger protein
• UniProt Gene Name: ZNF461
• UniProt Synonym Gene Names: GIOT1; GIOT-1
• UniProt Entry Name: ZN461_HUMAN

Uniprot Description

Function: May be involved in transcriptional regulation.

Subcellular location: Nucleus

Probable.

Tissue specificity: Widely expressed, with highest levels in liver, kidney, pancreas, thymus, and small intestine. Ref.1

Sequence similarities: Belongs to the krueppel C2H2-type zinc-finger protein family.Contains 12 C2H2-type zinc fingers.Contains 1 KRAB domain.