Western Blot (WB)
(Western Blot detection against Immunogen (36.89kD).)
Mouse anti-Human ZNF461 Monoclonal Antibody | anti-ZNF461 antibody
ZNF461 (Zinc Finger Protein 461, Gonadotropin-inducible Ovary Transcription Repressor 1, GIOT-1, GIOT1, MGC33911)
Gene Names
ZNF461; GIOT1; GIOT-1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
ZNF461; Monoclonal Antibody; ZNF461 (Zinc Finger Protein 461; Gonadotropin-inducible Ovary Transcription Repressor 1; GIOT-1; GIOT1; MGC33911); Anti -ZNF461 (Zinc Finger Protein 461; anti-ZNF461 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G11
Specificity
Recognizes human GIOT-1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
ELSQWVNMEEFKSHSPERSIFSAIWEGNCHFEQHQGQEEGYFRQLMINHENMPIFSQHTLLTQEFYDREKISECKKCRKIFSYHLFFSHHKRTHSKEL
Applicable Applications for anti-ZNF461 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa121-219 from human GIOT-1 (NP_694989) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (36.89kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (36.89kD).)
Testing Data
(Detection limit for recombinant GST tagged ZNF461 is 0.1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged ZNF461 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-ZNF461 antibody
May be involved in transcriptional regulation.
Product Categories/Family for anti-ZNF461 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
66,214 Da
NCBI Official Full Name
zinc finger protein 461
NCBI Official Synonym Full Names
zinc finger protein 461
NCBI Official Symbol
ZNF461
NCBI Official Synonym Symbols
GIOT1; GIOT-1
NCBI Protein Information
zinc finger protein 461; gonadotropin inducible transcription repressor 1; gonadotropin-inducible ovary transcription repressor 1
UniProt Protein Name
Zinc finger protein 461
Protein Family
UniProt Gene Name
ZNF461
UniProt Synonym Gene Names
GIOT1; GIOT-1
UniProt Entry Name
ZN461_HUMAN
Uniprot Description
ZNF461: May be involved in transcriptional regulation. Belongs to the krueppel C2H2-type zinc-finger protein family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Nuclear receptor co-regulator; C2H2-type zinc finger protein
Chromosomal Location of Human Ortholog: 19q13.12
Cellular Component: nucleus
Molecular Function: DNA binding; metal ion binding; transcription factor activity
Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent
Research Articles on ZNF461
Similar Products
Product Notes
The ZNF461 znf461 (Catalog #AAA644877) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZNF461 (Zinc Finger Protein 461, Gonadotropin-inducible Ovary Transcription Repressor 1, GIOT-1, GIOT1, MGC33911) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF461 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the ZNF461 znf461 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ELSQWVNMEE FKSHSPERSI FSAIWEGNCH FEQHQGQEEG YFRQLMINHE NMPIFSQHTL LTQEFYDREK ISECKKCRKI FSYHLFFSHH KRTHSKEL. It is sometimes possible for the material contained within the vial of "ZNF461, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
