Western Blot (WB)
(WB Suggested Anti-ZNF280C Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)
Rabbit ZNF280C Polyclonal Antibody | anti-ZNF280C antibody
ZNF280C antibody - N-terminal region
Gene Names
ZNF280C; SUHW3; ZNF633
Reactivity
Dog, Horse, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZNF280C; Polyclonal Antibody; ZNF280C antibody - N-terminal region; anti-ZNF280C antibody
Host
Rabbit
Reactivity
Dog, Horse, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DDDKPFQPKNISKMAELFMECEEEELEPWQKKVEETQDEDDDELIFVGEI
Sequence Length
737
Applicable Applications for anti-ZNF280C antibody
Western Blot (WB)
Homology
Dog: 83%; Horse: 79%; Human: 100%; Pig: 79%; Rabbit: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF280C
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ZNF280C Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)
Western Blot (WB)
(WB Suggested Anti-ZNF280C Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)
Related Product Information for anti-ZNF280C antibody
This is a rabbit polyclonal antibody against ZNF280C. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: ZNF280C contains 5 C2H2-type zinc fingers. It may function as a transcription factor.
Target Description: ZNF280C contains 5 C2H2-type zinc fingers. It may function as a transcription factor.
Product Categories/Family for anti-ZNF280C antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83kDa
NCBI Official Full Name
zinc finger protein 280C
NCBI Official Synonym Full Names
zinc finger protein 280C
NCBI Official Symbol
ZNF280C
NCBI Official Synonym Symbols
SUHW3; ZNF633
NCBI Protein Information
zinc finger protein 280C
UniProt Protein Name
Zinc finger protein 280C
Protein Family
UniProt Gene Name
ZNF280C
UniProt Synonym Gene Names
SUHW3; ZNF633
UniProt Entry Name
Z280C_HUMAN
NCBI Description
This gene encodes a member of the zinc finger domain-containing protein family. This family member contains multiple Cys2-His2(C2H2)-type zinc finger domains, the most common type of zinc finger domain that self-folds to form a beta-beta-alpha structure that binds a zinc ion. [provided by RefSeq, Aug 2011]
Uniprot Description
ZNF280C: May function as a transcription factor.
Protein type: C2H2-type zinc finger protein; Transcription factor
Chromosomal Location of Human Ortholog: Xq26.1
Cellular Component: nucleus
Molecular Function: DNA binding; metal ion binding
Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent
Research Articles on ZNF280C
Similar Products
Product Notes
The ZNF280C znf280c (Catalog #AAA3204547) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF280C antibody - N-terminal region reacts with Dog, Horse, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF280C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZNF280C znf280c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DDDKPFQPKN ISKMAELFME CEEEELEPWQ KKVEETQDED DDELIFVGEI. It is sometimes possible for the material contained within the vial of "ZNF280C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
