Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ZNF436Sample Type: ACHN Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit ZNF197 Polyclonal Antibody | anti-ZNF197 antibody

ZNF197 Antibody - middle region

Gene Names
ZNF197; P18; VHLaK; ZNF20; ZNF166; ZKSCAN9; ZSCAN41; D3S1363E
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZNF197; Polyclonal Antibody; ZNF197 Antibody - middle region; anti-ZNF197 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PHKCNECGKSFCRLSHLIQHQRTHSGEKPYECEECGKSFSRSSHLAQHQR
Sequence Length
302
Applicable Applications for anti-ZNF197 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 92%; Sheep: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZNF197
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ZNF436Sample Type: ACHN Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ZNF436Sample Type: ACHN Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ZNF197 antibody
This is a rabbit polyclonal antibody against ZNF436. It was validated on Western Blot

Target Description: This gene product belongs to the zinc finger protein superfamily, members of which are regulatory proteins characterized by nucleic acid-binding zinc finger domains. The encoded protein contains 20 tandemly arrayed C2H2-type zinc fingers, a Kruppel-associated box (KRAB) domain, and a SCAN box. This transcript turns over rapidly and contains 3' UTR AUUUA motifs, which are often a hallmark of rapid turnover. It is overexpressed in some thyroid papillary carcinomas. This gene is located in a cluster of zinc finger genes at 3p21. Two alternatively spliced transcripts encoding different isoforms have been described.
Product Categories/Family for anti-ZNF197 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
zinc finger protein 197 isoform 2
NCBI Official Synonym Full Names
zinc finger protein 197
NCBI Official Symbol
ZNF197
NCBI Official Synonym Symbols
P18; VHLaK; ZNF20; ZNF166; ZKSCAN9; ZSCAN41; D3S1363E
NCBI Protein Information
zinc finger protein 197
UniProt Protein Name
Zinc finger protein 197
Protein Family
UniProt Gene Name
ZNF197
UniProt Synonym Gene Names
ZKSCAN9; ZNF166
UniProt Entry Name
ZN197_HUMAN

NCBI Description

This gene product belongs to the zinc finger protein superfamily, members of which are regulatory proteins characterized by nucleic acid-binding zinc finger domains. The encoded protein contains 20 tandemly arrayed C2H2-type zinc fingers, a Kruppel-associated box (KRAB) domain, and a SCAN box. This transcript turns over rapidly and contains 3' UTR AUUUA motifs, which are often a hallmark of rapid turnover. It is overexpressed in some thyroid papillary carcinomas. This gene is located in a cluster of zinc finger genes at 3p21. Naturally-occurring readthrough transcription is observed between this gene and the upstream zinc finger protein 660 gene and is represented by GeneID:110354863. [provided by RefSeq, May 2017]

Uniprot Description

ZNF197: May be involved in transcriptional regulation. Belongs to the krueppel C2H2-type zinc-finger protein family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; DNA-binding; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 3p21

Cellular Component: nucleus

Molecular Function: DNA binding; metal ion binding; transcription factor activity

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent

Research Articles on ZNF197

Similar Products

Product Notes

The ZNF197 znf197 (Catalog #AAA3219120) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF197 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF197 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZNF197 znf197 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PHKCNECGKS FCRLSHLIQH QRTHSGEKPY ECEECGKSFS RSSHLAQHQR. It is sometimes possible for the material contained within the vial of "ZNF197, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.