Rabbit anti-Mouse ZNF177 Polyclonal Antibody | anti-ZNF177 antibody
ZNF177 Polyclonal Antibody
Reactivity
Mouse
Applications
Immunohistochemistry
Purity
Affinity Purification
Synonyms
ZNF177; Polyclonal Antibody; ZNF177 Polyclonal Antibody; PIGX; anti-ZNF177 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
LASVGYQLCRHSLISKVDQEQLKTDERGILQGDCADWETQLKPKDTIAMQNIPGGKTSNGI
Sequence Length
321
Applicable Applications for anti-ZNF177 antibody
Immunohistochemistry (IHC)
Application Notes
IHC: 1:50 - 1:200
Immunogen
Recombinant protein of human ZNF177
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Product Categories/Family for anti-ZNF177 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
13kDa/36kDa/54kDa
NCBI Official Full Name
zinc finger protein 177 isoform b
NCBI Official Synonym Full Names
ZNF559-ZNF177 readthrough
NCBI Official Symbol
ZNF559-ZNF177
NCBI Protein Information
zinc finger protein 177
UniProt Protein Name
Zinc finger protein 177
Protein Family
UniProt Gene Name
ZNF177
NCBI Description
This locus represents naturally occurring read-through transcription between the neighboring zinc finger protein 559 (ZNF559) and zinc finger protein 177 (ZNF177) genes on chromosome 19. Alternative splicing results in multiple transcript variants, which encode the ZNF177 protein due to either leaky scanning by ribosomes, or absence of the ZNF559 start codon. [provided by RefSeq, Jan 2011]
Uniprot Description
May be involved in transcriptional regulation.
Similar Products
Product Notes
The ZNF177 znf177 (Catalog #AAA9134794) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF177 Polyclonal Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF177 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC). IHC: 1:50 - 1:200. Researchers should empirically determine the suitability of the ZNF177 znf177 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LASVGYQLCR HSLISKVDQE QLKTDERGIL QGDCADWETQ LKPKDTIAMQ NIPGGKTSNG I. It is sometimes possible for the material contained within the vial of "ZNF177, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
