Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ZMYM3 Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)

Rabbit ZMYM3 Polyclonal Antibody | anti-ZMYM3 antibody

ZMYM3 antibody - N-terminal region

Gene Names
ZMYM3; MYM; XFIM; ZNF261; DXS6673E; ZNF198L2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
ZMYM3; Polyclonal Antibody; ZMYM3 antibody - N-terminal region; anti-ZMYM3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MDPSDFPSPFDPLTLPEKPLAGDLPVDMEFGEDLLESQTAPTRGWAPPGP
Sequence Length
1370
Applicable Applications for anti-ZMYM3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ZMYM3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ZMYM3 Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-ZMYM3 Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)
Related Product Information for anti-ZMYM3 antibody
This is a rabbit polyclonal antibody against ZMYM3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The function remains unknown. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Product Categories/Family for anti-ZMYM3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
152kDa
NCBI Official Full Name
zinc finger MYM-type protein 3 isoform 1
NCBI Official Synonym Full Names
zinc finger MYM-type containing 3
NCBI Official Symbol
ZMYM3
NCBI Official Synonym Symbols
MYM; XFIM; ZNF261; DXS6673E; ZNF198L2
NCBI Protein Information
zinc finger MYM-type protein 3
UniProt Protein Name
Zinc finger MYM-type protein 3
UniProt Gene Name
ZMYM3
UniProt Synonym Gene Names
DXS6673E; KIAA0385; ZNF261
UniProt Entry Name
ZMYM3_HUMAN

NCBI Description

This gene is located on the X chromosome and is subject to X inactivation. It is highly conserved in vertebrates and most abundantly expressed in the brain. The encoded protein is a component of histone deacetylase-containing multiprotein complexes that function through modifying chromatin structure to keep genes silent. A chromosomal translocation (X;13) involving this gene is associated with X-linked cognitive disability. Several alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2010]

Uniprot Description

ZNF261: Plays a role in the regulation of cell morphology and cytoskeletal organization. A chromosomal aberration involving ZMYM3 may be a cause of X-linked mental retardation in Xq13.1. Translocation t(X;13)(q13.1;?). 3 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: Xq13.1

Cellular Component: nucleus

Molecular Function: DNA binding; zinc ion binding

Biological Process: multicellular organismal development; regulation of cell morphogenesis; cytoskeleton organization and biogenesis

Research Articles on ZMYM3

Similar Products

Product Notes

The ZMYM3 zmym3 (Catalog #AAA3202110) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZMYM3 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZMYM3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZMYM3 zmym3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MDPSDFPSPF DPLTLPEKPL AGDLPVDMEF GEDLLESQTA PTRGWAPPGP. It is sometimes possible for the material contained within the vial of "ZMYM3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.