Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ZMIZ2 AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole Cell)

Rabbit ZMIZ2 Polyclonal Antibody | anti-ZMIZ2 antibody

ZMIZ2 antibody - middle region

Gene Names
ZMIZ2; NET27; ZIMP7; hZIMP7; TRAFIP20
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZMIZ2; Polyclonal Antibody; ZMIZ2 antibody - middle region; anti-ZMIZ2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HYKPTRSIPGYPSSPLPGNPTPPMTPSSSVPYMSPNQEVKSPFLPDLKPN
Sequence Length
894
Applicable Applications for anti-ZMIZ2 antibody
Western Blot (WB)
Homology
Cow: 86%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%; Zebrafish: 85%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ZMIZ2 AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole Cell)

Western Blot (WB) (WB Suggested Anti-ZMIZ2 AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole Cell)
Related Product Information for anti-ZMIZ2 antibody
This is a rabbit polyclonal antibody against ZMIZ2. It was validated on Western Blot

Target Description: ZMIZ2 and ZMIZ1 are members of a PIAS -like family of proteins that interact with nuclear hormone receptors. ZMIZ2 interacts with androgen receptor and enhances AR-mediated transcription

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
94kDa
NCBI Official Full Name
zinc finger MIZ domain-containing protein 2 isoform 2
NCBI Official Synonym Full Names
zinc finger MIZ-type containing 2
NCBI Official Symbol
ZMIZ2
NCBI Official Synonym Symbols
NET27; ZIMP7; hZIMP7; TRAFIP20
NCBI Protein Information
zinc finger MIZ domain-containing protein 2
UniProt Protein Name
Zinc finger MIZ domain-containing protein 2
UniProt Gene Name
ZMIZ2
UniProt Synonym Gene Names
KIAA1886; ZIMP7
UniProt Entry Name
ZMIZ2_HUMAN

NCBI Description

ZMIZ2 and ZMIZ1 (MIM 607159) are members of a PIAS (see MIM 603566)-like family of proteins that interact with nuclear hormone receptors. ZMIZ2 interacts with androgen receptor (AR; MIM 313700) and enhances AR-mediated transcription (Huang et al., 2005 [PubMed 16051670]).[supplied by OMIM, May 2010]

Uniprot Description

ZIMP7: Increases ligand-dependent transcriptional activity of AR and other nuclear hormone receptors. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 7p13

Cellular Component: nucleoplasm; mitochondrion; nuclear replication fork; nucleus

Molecular Function: protein binding; ligand-dependent nuclear receptor transcription coactivator activity; zinc ion binding

Biological Process: transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter

Research Articles on ZMIZ2

Similar Products

Product Notes

The ZMIZ2 zmiz2 (Catalog #AAA3214878) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZMIZ2 antibody - middle region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ZMIZ2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZMIZ2 zmiz2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HYKPTRSIPG YPSSPLPGNP TPPMTPSSSV PYMSPNQEVK SPFLPDLKPN. It is sometimes possible for the material contained within the vial of "ZMIZ2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.