Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using ZMIZ2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Rabbit ZMIZ2 Polyclonal Antibody | anti-ZMIZ2 antibody

ZMIZ2 Rabbit pAb

Gene Names
ZMIZ2; NET27; ZIMP7; hZIMP7; TRAFIP20
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
ZMIZ2; Polyclonal Antibody; ZMIZ2 Rabbit pAb; NET27; TRAFIP20; ZIMP7; hZIMP7; anti-ZMIZ2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MNSMNPMKPALPPAPHGDGSFAYESVPWQQSATQPAGSLSVVTTVWGVGNATQSQCLGQQAFAEGGANKGYVQQGVYSRGGYPGAPGFTTGYAGGPGGLGLPSHAARPST
Applicable Applications for anti-ZMIZ2 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human ZMIZ2 (NP_001287888).
Positive Samples
U-87MG, Jurkat, HeLa, 293T, mouse brain, rat brain
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using ZMIZ2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using ZMIZ2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-ZMIZ2 antibody
Background: ZMIZ2 and ZMIZ1 (MIM 607159) are members of a PIAS (see MIM 603566)-like family of proteins that interact with nuclear hormone receptors. ZMIZ2 interacts with androgen receptor (AR; MIM 313700) and enhances AR-mediated transcription.
References
Huang et al., 2005 [PubMed 16051670]

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
91,112 Da
NCBI Official Full Name
zinc finger MIZ domain-containing protein 2 isoform 1
NCBI Official Synonym Full Names
zinc finger, MIZ-type containing 2
NCBI Official Symbol
ZMIZ2
NCBI Official Synonym Symbols
NET27; ZIMP7; hZIMP7; TRAFIP20
NCBI Protein Information
zinc finger MIZ domain-containing protein 2; PIAS-like protein Zimp7
UniProt Protein Name
Zinc finger MIZ domain-containing protein 2
UniProt Gene Name
ZMIZ2
UniProt Synonym Gene Names
KIAA1886; ZIMP7
UniProt Entry Name
ZMIZ2_HUMAN

NCBI Description

ZMIZ2 and ZMIZ1 (MIM 607159) are members of a PIAS (see MIM 603566)-like family of proteins that interact with nuclear hormone receptors. ZMIZ2 interacts with androgen receptor (AR; MIM 313700) and enhances AR-mediated transcription (Huang et al., 2005 [PubMed 16051670]).[supplied by OMIM, May 2010]

Uniprot Description

ZIMP7: Increases ligand-dependent transcriptional activity of AR and other nuclear hormone receptors. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 7p13

Cellular Component: nucleoplasm; mitochondrion; nuclear replication fork; nucleus

Molecular Function: protein binding; ligand-dependent nuclear receptor transcription coactivator activity; zinc ion binding

Biological Process: transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter

Research Articles on ZMIZ2

Similar Products

Product Notes

The ZMIZ2 zmiz2 (Catalog #AAA9142703) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZMIZ2 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZMIZ2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the ZMIZ2 zmiz2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MNSMNPMKPA LPPAPHGDGS FAYESVPWQQ SATQPAGSLS VVTTVWGVGN ATQSQCLGQQ AFAEGGANKG YVQQGVYSRG GYPGAPGFTT GYAGGPGGLG LPSHAARPST. It is sometimes possible for the material contained within the vial of "ZMIZ2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.