Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Lanes:Lane 1: 50ug mouse retina extractLane 2: 50ug mouse prostate extractLane 3: 50ug mouse testis extractLane 4: 50ug mouse colon extractPrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:10,000Gene Name:ZMIZ1Submitted by:John Fu, UVA)

Rabbit ZMIZ1 Polyclonal Antibody | anti-ZMIZ1 antibody

ZMIZ1 antibody - N-terminal region

Gene Names
ZMIZ1; MIZ; RAI17; ZIMP10; TRAFIP10
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZMIZ1; Polyclonal Antibody; ZMIZ1 antibody - N-terminal region; anti-ZMIZ1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MNSMDRHIQQTNDRLQCIKQHLQNPANFHNAATELLDWCGDPRAFQRPFE
Sequence Length
1067
Applicable Applications for anti-ZMIZ1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 82%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ZMIZ1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Lanes:Lane 1: 50ug mouse retina extractLane 2: 50ug mouse prostate extractLane 3: 50ug mouse testis extractLane 4: 50ug mouse colon extractPrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:10,000Gene Name:ZMIZ1Submitted by:John Fu, UVA)

Western Blot (WB) (Lanes:Lane 1: 50ug mouse retina extractLane 2: 50ug mouse prostate extractLane 3: 50ug mouse testis extractLane 4: 50ug mouse colon extractPrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:10,000Gene Name:ZMIZ1Submitted by:John Fu, UVA)

Western Blot (WB)

(WB Suggested Anti-ZMIZ1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: 293T cell lysate)

Western Blot (WB) (WB Suggested Anti-ZMIZ1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: 293T cell lysate)
Related Product Information for anti-ZMIZ1 antibody
This is a rabbit polyclonal antibody against ZMIZ1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ZMIZ1 increases ligand-dependent transcriptional activity of AR and promotes AR sumoylation. The stimulation of AR activity is dependent upon sumoylation.
Product Categories/Family for anti-ZMIZ1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
115kDa
NCBI Official Full Name
zinc finger MIZ domain-containing protein 1
NCBI Official Synonym Full Names
zinc finger MIZ-type containing 1
NCBI Official Symbol
ZMIZ1
NCBI Official Synonym Symbols
MIZ; RAI17; ZIMP10; TRAFIP10
NCBI Protein Information
zinc finger MIZ domain-containing protein 1
UniProt Protein Name
Zinc finger MIZ domain-containing protein 1
UniProt Gene Name
ZMIZ1
UniProt Synonym Gene Names
KIAA1224; RAI17; ZIMP10
UniProt Entry Name
ZMIZ1_HUMAN

NCBI Description

This gene encodes a member of the PIAS (protein inhibitor of activated STAT) family of proteins. The encoded protein regulates the activity of various transcription factors, including the androgen receptor, Smad3/4, and p53. The encoded protein may also play a role in sumoylation. A translocation between this locus on chromosome 10 and the protein tyrosine kinase ABL1 locus on chromosome 9 has been associated with acute lymphoblastic leukemia. [provided by RefSeq, Mar 2010]

Uniprot Description

RAI17: Increases ligand-dependent transcriptional activity of AR and promotes AR sumoylation. The stimulation of AR activity is dependent upon sumoylation. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 10q22.3

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; cytoplasm; nuclear speck

Molecular Function: zinc ion binding

Biological Process: heart morphogenesis; developmental growth; positive regulation of fibroblast proliferation; transcription, DNA-dependent; in utero embryonic development; vitellogenesis; artery morphogenesis; cell aging; positive regulation of transcription from RNA polymerase II promoter; vasculogenesis

Research Articles on ZMIZ1

Similar Products

Product Notes

The ZMIZ1 zmiz1 (Catalog #AAA3204610) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZMIZ1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ZMIZ1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZMIZ1 zmiz1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MNSMDRHIQQ TNDRLQCIKQ HLQNPANFHN AATELLDWCG DPRAFQRPFE. It is sometimes possible for the material contained within the vial of "ZMIZ1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.