Western Blot (WB)
(WB Suggested Anti-ZFYVE27 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)
Rabbit ZFYVE27 Polyclonal Antibody | anti-ZFYVE27 antibody
ZFYVE27 antibody - middle region
Gene Names
ZFYVE27; SPG33; PROTRUDIN
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
ZFYVE27; Polyclonal Antibody; ZFYVE27 antibody - middle region; anti-ZFYVE27 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VGGKDGLMDSTPALTPTESLSSQDLTPGSVEEAEEAEPDEEFKDAIEETH
Sequence Length
416
Applicable Applications for anti-ZFYVE27 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 75%; Zebrafish: 82%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZFYVE27
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ZFYVE27 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)
Western Blot (WB)
(WB Suggested Anti-ZFYVE27 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-ZFYVE27 antibody
This is a rabbit polyclonal antibody against ZFYVE27. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: ZFYVE27 may be associated with the neuronal intracellular trafficking in the corticospinal tract, which is consistent with the pathology of HSP.
Target Description: ZFYVE27 may be associated with the neuronal intracellular trafficking in the corticospinal tract, which is consistent with the pathology of HSP.
Product Categories/Family for anti-ZFYVE27 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
protrudin isoform a
NCBI Official Synonym Full Names
zinc finger FYVE-type containing 27
NCBI Official Symbol
ZFYVE27
NCBI Official Synonym Symbols
SPG33; PROTRUDIN
NCBI Protein Information
protrudin
UniProt Protein Name
Protrudin
Protein Family
UniProt Gene Name
ZFYVE27
UniProt Entry Name
ZFY27_HUMAN
NCBI Description
This gene encodes a protein with several transmembrane domains, a Rab11-binding domain and a lipid-binding FYVE finger domain. The encoded protein appears to promote neurite formation. A mutation in this gene has been reported to be associated with hereditary spastic paraplegia, however the pathogenicity of the mutation, which may simply represent a polymorphism, is unclear. [provided by RefSeq, Mar 2010]
Research Articles on ZFYVE27
Similar Products
Product Notes
The ZFYVE27 zfyve27 (Catalog #AAA3207363) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZFYVE27 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ZFYVE27 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZFYVE27 zfyve27 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VGGKDGLMDS TPALTPTESL SSQDLTPGSV EEAEEAEPDE EFKDAIEETH. It is sometimes possible for the material contained within the vial of "ZFYVE27, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
