Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: Zfp36I1Sample Type: Mouse LiverAntibody Dilution: 1.0ug/ml)

Rabbit Zfp36l1 Polyclonal Antibody | anti-ZFP36L1 antibody

Zfp36l1 antibody - C-terminal region

Gene Names
Zfp36l1; Brf1; ERF1; cMG1; Berg36; TIS11b; AW742437; AW743212; D530020L18Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Zfp36l1; Polyclonal Antibody; Zfp36l1 antibody - C-terminal region; anti-ZFP36L1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PMSESPHMFDSPPSPQDSLSDHEGYLSSSSSSHSGSDSPTLDNSRRLPIF
Sequence Length
338
Applicable Applications for anti-ZFP36L1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: Zfp36I1Sample Type: Mouse LiverAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: Zfp36I1Sample Type: Mouse LiverAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-Zfp36l1 antibody Titration: 1 ug/mLSample Type: Human heart)

Western Blot (WB) (WB Suggested Anti-Zfp36l1 antibody Titration: 1 ug/mLSample Type: Human heart)
Related Product Information for anti-ZFP36L1 antibody
This is a rabbit polyclonal antibody against Zfp36l1. It was validated on Western Blot

Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-ZFP36L1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
mRNA decay activator protein ZFP36L1
NCBI Official Synonym Full Names
zinc finger protein 36, C3H type-like 1
NCBI Official Symbol
Zfp36l1
NCBI Official Synonym Symbols
Brf1; ERF1; cMG1; Berg36; TIS11b; AW742437; AW743212; D530020L18Rik
NCBI Protein Information
mRNA decay activator protein ZFP36L1
UniProt Protein Name
mRNA decay activator protein ZFP36L1
UniProt Gene Name
Zfp36l1
UniProt Synonym Gene Names
ZFP36-like 1

Uniprot Description

BRF1: a zinc finger protein that plays an important role in the assembly of the RNA polymerase III initiation factor TFIIIB. Regulates mRNA levels by targeting transcripts containing AREs (AU-rich elements) into the decay pathway. Phosphorylation by Akt apparently generates 14-3-3 binding sites and inhibits BRF1 from promoting mRNA activity.Contains 2 C3H1-type zinc fingers.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 12|12 C3

Cellular Component: cytoplasm; cytosol; intracellular ribonucleoprotein complex; nucleus; P-body

Molecular Function: 14-3-3 protein binding; AU-rich element binding; DNA binding; metal ion binding; mRNA binding; protein binding; RNA binding

Biological Process: apoptosis; cell proliferation; cellular response to cAMP; cellular response to epidermal growth factor stimulus; cellular response to fibroblast growth factor stimulus; cellular response to glucocorticoid stimulus; cellular response to hypoxia; cellular response to insulin stimulus; cellular response to peptide hormone stimulus; cellular response to phorbol 13-acetate 12-myristate; cellular response to salt stress; cellular response to transforming growth factor beta stimulus; cellular response to tumor necrosis factor; embryonic organ development; ERK1 and ERK2 cascade; heart development; MAPK cascade; mesendoderm development; mRNA catabolic process; mRNA catabolic process, deadenylation-dependent decay; mRNA catabolic process, deadenylation-independent decay; mRNA processing; mRNA transport; multicellular organism development; multicellular organism growth; negative regulation of erythrocyte differentiation; negative regulation of mitotic cell cycle phase transition; neural tube development; p38MAPK cascade; phosphoinositide 3-kinase cascade; positive regulation of fat cell differentiation; positive regulation of intracellular mRNA localization; positive regulation of monocyte differentiation; positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay; proepicardium development; protein kinase B signaling; regulation of B cell differentiation; regulation of gene expression; regulation of keratinocyte apoptotic process; regulation of keratinocyte differentiation; regulation of keratinocyte proliferation; regulation of mRNA 3'-end processing; regulation of mRNA stability; regulation of myoblast differentiation; regulation of stem cell proliferation; regulation of translation; response to wounding; T cell differentiation in thymus; transport; vasculogenesis

Research Articles on ZFP36L1

Similar Products

Product Notes

The ZFP36L1 zfp36l1 (Catalog #AAA3213621) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Zfp36l1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Zfp36l1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZFP36L1 zfp36l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PMSESPHMFD SPPSPQDSLS DHEGYLSSSS SSHSGSDSPT LDNSRRLPIF. It is sometimes possible for the material contained within the vial of "Zfp36l1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.