Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using CLEC4C antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)

Rabbit anti-Human, Mouse CLEC4C Polyclonal Antibody | anti-CLEC4C antibody

CLEC4C Polyclonal Antibody

Gene Names
CLEC4C; DLEC; HECL; BDCA2; CD303; CLECSF7; CLECSF11; PRO34150
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
CLEC4C; Polyclonal Antibody; CLEC4C Polyclonal Antibody; BDCA2; CD303; CLECSF11; CLECSF7; DLEC; HECL; PRO34150; anti-CLEC4C antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
Sequence Length
213
Applicable Applications for anti-CLEC4C antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human CLEC4C
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Membrane, Single-pass type II membrane protein
Positive Samples
K-562, Mouse spleen
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using CLEC4C antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using CLEC4C antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Related Product Information for anti-CLEC4C antibody
This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may play a role in dendritic cell function. Two transcript variants encoding distinct isoforms have been identified for this gene.
Product Categories/Family for anti-CLEC4C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 21kDa; 25kDa
Observed: 38kDa
NCBI Official Full Name
C-type lectin domain family 4 member C isoform 1
NCBI Official Synonym Full Names
C-type lectin domain family 4 member C
NCBI Official Symbol
CLEC4C
NCBI Official Synonym Symbols
DLEC; HECL; BDCA2; CD303; CLECSF7; CLECSF11; PRO34150
NCBI Protein Information
C-type lectin domain family 4 member C
UniProt Protein Name
C-type lectin domain family 4 member C
UniProt Gene Name
CLEC4C
UniProt Synonym Gene Names
BDCA2; CLECSF11; CLECSF7; DLEC; HECL; BDCA-2

NCBI Description

This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may play a role in dendritic cell function. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Lectin-type cell surface receptor which may play a role in antigen capturing by dendritic cells (PubMed:11748283, PubMed:21880719, PubMed:25995448). Specifically recognizes non-sialylated galactose-terminated biantennary glycans containing the trisaccharide epitope Gal(beta1-3/4)GlcNAc(beta1-2)Man (PubMed:21880719, PubMed:25995448). Binds to serum IgG (PubMed:25995448). Efficiently targets ligand into antigen-processing and peptide-loading compartments for presentation to T-cells (PubMed:11748283). May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells (PubMed:11748283, PubMed:21880719). May act as a signaling receptor that activates protein-tyrosine kinases and mobilizes intracellular calcium (PubMed:11748283).

Research Articles on CLEC4C

Similar Products

Product Notes

The CLEC4C clec4c (Catalog #AAA9133730) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CLEC4C Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CLEC4C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the CLEC4C clec4c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NFMYSKTVKR LSKLREYQQY HPSLTCVMEG KDIEDWSCCP TPWTSFQSSC YFISTGMQSW TKSQKNCSVM GADLVVINTR EEQDFIIQNL KRNSSYFLGL SDPGGRRHWQ WVDQTPYNEN VTFWHSGEPN NLDERCAIIN FRSSEEWGWN DIHCHVPQKS ICKMKKIYI. It is sometimes possible for the material contained within the vial of "CLEC4C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.