Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ZDHHC17 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysateZDHHC17 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Rabbit ZDHHC17 Polyclonal Antibody | anti-ZDHHC17 antibody

ZDHHC17 antibody - middle region

Gene Names
ZDHHC17; HIP3; HYPH; HIP14; DHHC-17; HSPC294
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
ZDHHC17; Polyclonal Antibody; ZDHHC17 antibody - middle region; anti-ZDHHC17 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FLVIWLVGFIADLNIDSWLIKGLMYGGVWATVQFLSKSFFDHSMHSALPL
Sequence Length
400
Applicable Applications for anti-ZDHHC17 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZDHHC17
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ZDHHC17 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysateZDHHC17 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Western Blot (WB) (WB Suggested Anti-ZDHHC17 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysateZDHHC17 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)
Related Product Information for anti-ZDHHC17 antibody
This is a rabbit polyclonal antibody against ZDHHC17. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ZDHHC17 is a palmitoyltransferase specific for a subset of neuronal proteins, including SNAP25, DLG4/PSD95, GAD2, SYT1 and HD. It may be involved in the sorting or targeting of critical proteins involved in the initiating events of endocytosis at the plasma membrane. It may be involved in the NF-kappa-B signaling pathway and has transforming activity.
Product Categories/Family for anti-ZDHHC17 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
zinc finger, DHHC-type containing 17, isoform CRA_c
NCBI Official Synonym Full Names
zinc finger DHHC-type containing 17
NCBI Official Symbol
ZDHHC17
NCBI Official Synonym Symbols
HIP3; HYPH; HIP14; DHHC-17; HSPC294
NCBI Protein Information
palmitoyltransferase ZDHHC17
UniProt Protein Name
Palmitoyltransferase ZDHHC17
Protein Family
UniProt Gene Name
ZDHHC17
UniProt Synonym Gene Names
HIP14; HIP3; HYPH; KIAA0946; HIP-14; HIP-3; DHHC-17
UniProt Entry Name
ZDH17_HUMAN

Uniprot Description

HIP14: a palmitoyltransferase specific for a subset of neuronal proteins, including SNAP25, PSD-95, GAD2, SYT1 and Huntingtin. May be involved in the sorting or targeting of critical proteins involved in the initiating events of endocytosis at the plasma membrane. May be involved in the NF-kappa-B signaling pathway. Can cause cellular transformation, and is up-regulated in a number of types of human tumors. Expressed in all brain regions. Expression is highest in the cortex, cerebellum, occipital lobe and caudate, and lowest in the spinal cord. Expression is also seen in testis, pancreas, heart and kidney. Three alternatively spliced isoforms have been described.

Protein type: EC 2.3.1.225; Transferase; Membrane protein, multi-pass; Membrane protein, integral; Tumor suppressor

Chromosomal Location of Human Ortholog: 12q21.2

Cellular Component: Golgi membrane; Golgi apparatus; intracellular membrane-bound organelle; cytoplasm; integral to membrane

Molecular Function: identical protein binding; signal transducer activity; protein binding; zinc ion binding; palmitoyltransferase activity; magnesium ion transmembrane transporter activity; protein-cysteine S-palmitoleyltransferase activity

Biological Process: protein palmitoylation; positive regulation of I-kappaB kinase/NF-kappaB cascade; lipoprotein transport; signal transduction; magnesium ion transport

Research Articles on ZDHHC17

Similar Products

Product Notes

The ZDHHC17 zdhhc17 (Catalog #AAA3208443) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZDHHC17 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ZDHHC17 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZDHHC17 zdhhc17 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FLVIWLVGFI ADLNIDSWLI KGLMYGGVWA TVQFLSKSFF DHSMHSALPL. It is sometimes possible for the material contained within the vial of "ZDHHC17, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.