Western Blot (WB)
(Western blot analysis of extracts of Raji cells, using ZC3H10 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Rabbit anti-Human ZC3H10 Polyclonal Antibody | anti-ZC3H10 antibody
ZC3H10 Polyclonal Antibody
Gene Names
ZC3H10; ZC3HDC10
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
ZC3H10; Polyclonal Antibody; ZC3H10 Polyclonal Antibody; ZC3HDC10; anti-ZC3H10 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MPDRDSYANGTGSSGGGPGGGGSEEASGAGVGSGGASSDAICRDFLRNVCKRGKRCRYRHPDMSEVSNLGVSKNEFIFCHDFQNKECSRPNCRFIHGSKEDEDGYKKTGELPPRLRQKVAAGLGLSPADLPNGKEEVPICRDFLKGDCQRGAKCKFRHLQRDFEFDARGGGGTGGGSTGSVLPGRRHDLYDIYDLPDRGFEDHEPGPKRRRGGCCPPDGPHFESYEYSLAPPRGVECRLLEEENAMLRKRVEELK
Sequence Length
434
Applicable Applications for anti-ZC3H10 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human ZC3H10
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Positive Samples
Raji
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of Raji cells, using ZC3H10 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Western Blot (WB)
(Western blot analysis of extracts of Raji cells, using ZC3H10 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Product Categories/Family for anti-ZC3H10 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 46kDa
Observed: 46kDa
Observed: 46kDa
NCBI Official Full Name
zinc finger CCCH domain-containing protein 10
NCBI Official Synonym Full Names
zinc finger CCCH-type containing 10
NCBI Official Symbol
ZC3H10
NCBI Official Synonym Symbols
ZC3HDC10
NCBI Protein Information
zinc finger CCCH domain-containing protein 10
UniProt Protein Name
Zinc finger CCCH domain-containing protein 10
Protein Family
UniProt Gene Name
ZC3H10
UniProt Synonym Gene Names
ZC3HDC10
Uniprot Description
Specific regulator of miRNA biogenesis. Binds, via the C3H1-type zinc finger domains, to the binding motif 5'-GCAGCGC-3' on microRNA pri-MIR143 and negatively regulates the processing to mature microRNA.
Research Articles on ZC3H10
Similar Products
Product Notes
The ZC3H10 zc3h10 (Catalog #AAA9133775) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZC3H10 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZC3H10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the ZC3H10 zc3h10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPDRDSYANG TGSSGGGPGG GGSEEASGAG VGSGGASSDA ICRDFLRNVC KRGKRCRYRH PDMSEVSNLG VSKNEFIFCH DFQNKECSRP NCRFIHGSKE DEDGYKKTGE LPPRLRQKVA AGLGLSPADL PNGKEEVPIC RDFLKGDCQR GAKCKFRHLQ RDFEFDARGG GGTGGGSTGS VLPGRRHDLY DIYDLPDRGF EDHEPGPKRR RGGCCPPDGP HFESYEYSLA PPRGVECRLL EEENAMLRKR VEELK. It is sometimes possible for the material contained within the vial of "ZC3H10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
