Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged CDH11 is ~0.3ng/ml as a capture antibody.)

Mouse anti-Human CDH11 Monoclonal Antibody | anti-CDH11 antibody

CDH11 (Cadherin 11, Cadherin-11, OSF-4, Osteoblast Cadherin, OB-cadherin) (HRP)

Gene Names
CDH11; OB; CAD11; CDHOB; OSF-4
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CDH11; Monoclonal Antibody; CDH11 (Cadherin 11; Cadherin-11; OSF-4; Osteoblast Cadherin; OB-cadherin) (HRP); anti-CDH11 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4D10
Specificity
Recognizes human CDH11.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-CDH11 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa509-617 from human CDH11 (NP_001788) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PIVTISADDKDDTANGPRFIFSLPPEIIHNPNFTVRDNRDNTAGVYARRGGFSRQKQDLYLLPIVISDGGIPPMSSTNTLTIKVCGCDVNGALLSCNAEAYILNAGLST
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CDH11 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CDH11 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-CDH11 antibody
Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.
Product Categories/Family for anti-CDH11 antibody
References
1. Development of a Surface Plasmon Resonance Biosensor for Real-Time Detection of Osteogenic Differentiation in Live Mesenchymal Stem Cells. Kuo YC, Ho JH, Yen TJ, Chen HF, Lee OK.PLoS One. 2011;6(7):e22382. Epub 2011 Jul 27.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76,457 Da
NCBI Official Full Name
cadherin-11 preproprotein
NCBI Official Synonym Full Names
cadherin 11, type 2, OB-cadherin (osteoblast)
NCBI Official Symbol
CDH11
NCBI Official Synonym Symbols
OB; CAD11; CDHOB; OSF-4
NCBI Protein Information
cadherin-11
UniProt Protein Name
Cadherin-11
Protein Family
UniProt Gene Name
CDH11
UniProt Synonym Gene Names
OB-cadherin
UniProt Entry Name
CAD11_HUMAN

Uniprot Description

CDH11: Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. Interacts with PCDH8. Expressed mainly in brain but also found in other tissues. Expressed in neuroblasts. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Cell adhesion; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 16q21

Cellular Component: cytoplasm; integral to membrane; plasma membrane

Molecular Function: calcium ion binding

Biological Process: intercellular junction assembly and maintenance; ossification; corticospinal tract morphogenesis; homophilic cell adhesion; cell adhesion; skeletal development

Similar Products

Product Notes

The CDH11 cdh11 (Catalog #AAA6151719) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CDH11 (Cadherin 11, Cadherin-11, OSF-4, Osteoblast Cadherin, OB-cadherin) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDH11 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDH11 cdh11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDH11, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.