Western Blot (WB)
(Western Blot analysis of ZFP161 expression in transfected 293T cell line by ZFP161 polyclonal antibody. Lane 1: ZFP161 transfected lysate (49.39kD). Lane 2: Non-transfected lysate.)
Mouse anti-Human ZBTB14 Polyclonal Antibody | anti-ZBTB14 antibody
ZBTB14 (Zinc Finger and BTB Domain-containing Protein 14, Zinc Finger Protein 5 Homolog, Zfp-5, hZF5, ZF5, Zinc Finger Protein 161 Homolog, ZFP161, Zfp-161, Zinc Finger Protein 478, ZNF478)
Gene Names
ZBTB14; ZF5; ZFP-5; ZFP161; ZNF478; ZFP-161
Reactivity
Human
Applications
Western Blot, Immunofluorescence
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
ZBTB14; Polyclonal Antibody; ZBTB14 (Zinc Finger and BTB Domain-containing Protein 14; Zinc Finger Protein 5 Homolog; Zfp-5; hZF5; ZF5; Zinc Finger Protein 161 Homolog; ZFP161; Zfp-161; Zinc Finger Protein 478; ZNF478); Anti -ZBTB14 (Zinc Finger and BTB Domain-containing Protein 14; anti-ZBTB14 antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ZFP161.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MEFFISMSETIKYNDDDHKTLFLKTLNEQRLEGEFCDIAIVVEDVKFRAHRCVLAACSTYFKKLFKKLEVDSSSVIEIDFLRSDIFEEVLNYMYTAKISVKKEDVNLMMSSGQILGIRFLDKLCSQKRDVSSPDENNGQSKSKYCLKINRPIGDAADTQDDDVEEIGDQDDSPSDDTVEGTPPSQEDGKSPTTTLRVQEAILKELGSEEVRKVNCYGQEVESMETPESKDLGSQTPQALTFNDGMSEVKDEQTPGWTTAASDMKFEYLLYGHHREQIACQACGKTFSDEGRLRKHEKLHTADRPFVCEMCTKGFTTQAHLKEHLKIHTGYKPYSCEVCGKSFIRAPDLKKHERVHSNERPFACHMCDKAFKHKSHLKDHERRHRGEKPFVCGSCTKAFAKASDLKRHENNMHSERKQVTPSAIQSETEQLQAAAMAAEAEQQLETIACS
Applicable Applications for anti-ZBTB14 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Western Blot and Immunofluorescence.
Dilution: Immunofluorescence: 10ug/ml
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length human ZFP161, aa1-449 (NP_003400.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of ZFP161 expression in transfected 293T cell line by ZFP161 polyclonal antibody. Lane 1: ZFP161 transfected lysate (49.39kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of ZFP161 expression in transfected 293T cell line by ZFP161 polyclonal antibody. Lane 1: ZFP161 transfected lysate (49.39kD). Lane 2: Non-transfected lysate.)
Immunofluorescence (IF)
(Immunofluorescence of purified antibody to ZFP161 on HeLa cell. [antibody concentration 10ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of purified antibody to ZFP161 on HeLa cell. [antibody concentration 10ug/ml])
Product Categories/Family for anti-ZBTB14 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
50,956 Da
NCBI Official Full Name
zinc finger and BTB domain-containing protein 14
NCBI Official Synonym Full Names
zinc finger and BTB domain containing 14
NCBI Official Symbol
ZBTB14
NCBI Official Synonym Symbols
ZF5; ZFP-5; ZFP161; ZNF478; ZFP-161
NCBI Protein Information
zinc finger and BTB domain-containing protein 14; zinc finger protein 478; ZFP161 zinc finger protein; zinc finger protein 5 homolog; zinc finger protein 161 homolog; zinc finger protein homologous to Zfp161 in mouse
UniProt Protein Name
Zinc finger and BTB domain-containing protein 14
Protein Family
UniProt Gene Name
ZBTB14
UniProt Synonym Gene Names
ZFP161; ZNF478; Zfp-161; ZF5; Zfp-5; hZF5
UniProt Entry Name
ZBT14_HUMAN
Uniprot Description
Function: Transcriptional activator of the dopamine transporter (DAT), binding it's promoter at the consensus sequence 5'-CCTGCACAGTTCACGGA-3'. Binds to 5'-d(GCC)(n)-3' trinucleotide repeats in promoter regions and acts as a repressor of the FMR1 gene. Transcriptional repressor of MYC and thymidine kinase promoters. Ref.4
Subunit structure: Interacts with ZBTB21. Ref.7
Subcellular location: Nucleus. Note: Colocalizes with ZBTB21 in nucleus in HEK293 cells. Ref.7
Domain: The BTB/POZ domain seems to direct the protein to discrete regions in the nucleus.
Sequence similarities: Belongs to the krueppel C2H2-type zinc-finger protein family.Contains 1 BTB (POZ) domain.Contains 5 C2H2-type zinc fingers.
Research Articles on ZBTB14
Similar Products
Product Notes
The ZBTB14 zbtb14 (Catalog #AAA648776) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZBTB14 (Zinc Finger and BTB Domain-containing Protein 14, Zinc Finger Protein 5 Homolog, Zfp-5, hZF5, ZF5, Zinc Finger Protein 161 Homolog, ZFP161, Zfp-161, Zinc Finger Protein 478, ZNF478) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZBTB14 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). Suitable for use in Western Blot and Immunofluorescence. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the ZBTB14 zbtb14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEFFISMSET IKYNDDDHKT LFLKTLNEQR LEGEFCDIAI VVEDVKFRAH RCVLAACSTY FKKLFKKLEV DSSSVIEIDF LRSDIFEEVL NYMYTAKISV KKEDVNLMMS SGQILGIRFL DKLCSQKRDV SSPDENNGQS KSKYCLKINR PIGDAADTQD DDVEEIGDQD DSPSDDTVEG TPPSQEDGKS PTTTLRVQEA ILKELGSEEV RKVNCYGQEV ESMETPESKD LGSQTPQALT FNDGMSEVKD EQTPGWTTAA SDMKFEYLLY GHHREQIACQ ACGKTFSDEG RLRKHEKLHT ADRPFVCEMC TKGFTTQAHL KEHLKIHTGY KPYSCEVCGK SFIRAPDLKK HERVHSNERP FACHMCDKAF KHKSHLKDHE RRHRGEKPFV CGSCTKAFAK ASDLKRHENN MHSERKQVTP SAIQSETEQL QAAAMAAEAE QQLETIACS. It is sometimes possible for the material contained within the vial of "ZBTB14, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
