Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Zap70 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Kidney)

Rabbit Zap70 Polyclonal Antibody | anti-ZAP70 antibody

Zap70 antibody - middle region

Gene Names
Zap70; Srk; mur; mrtle; ZAP-70
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Zap70; Polyclonal Antibody; Zap70 antibody - middle region; anti-ZAP70 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRENLLVADIELGCGNFGS
Sequence Length
618
Applicable Applications for anti-ZAP70 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Zap70 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Kidney)

Western Blot (WB) (WB Suggested Anti-Zap70 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Kidney)
Related Product Information for anti-ZAP70 antibody
This is a rabbit polyclonal antibody against Zap70. It was validated on Western Blot

Target Description: Zap70 is a tyrosine kinase that plays an essential role in regulation of the adaptive immune response. Zap70 regulates motility, adhesion and cytokine expression of mature T cells, as well as thymocyte development. Zap70 contributes also to the development and activation of primary B lymphocytes.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70kDa
NCBI Official Full Name
tyrosine-protein kinase ZAP-70 isoform a
NCBI Official Synonym Full Names
zeta-chain (TCR) associated protein kinase
NCBI Official Symbol
Zap70
NCBI Official Synonym Symbols
Srk; mur; mrtle; ZAP-70
NCBI Protein Information
tyrosine-protein kinase ZAP-70
UniProt Protein Name
Tyrosine-protein kinase ZAP-70
Protein Family
UniProt Gene Name
Zap70
UniProt Synonym Gene Names
Srk; Zap-70
UniProt Entry Name
ZAP70_MOUSE

NCBI Description

This gene encodes a member of the protein tyrosine kinase family. The encoded protein is essential for development of T lymphocytes and thymocytes, and functions in the initial step of T lymphocyte receptor-mediated signal transduction. A mutation in this gene causes chronic autoimmune arthritis, similar to rheumatoid arthritis in humans. Mice lacking this gene are deficient in alpha-beta T lymphocytes in the thymus. In humans, mutations in this gene cause selective T-cell defect, a severe combined immunodeficiency disease characterized by a selective absence of CD8-positive T lymphocytes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]

Uniprot Description

ZAP70: a tyrosine kinase of the Syk family. Associates with the T-cell antigen receptor zeta-chain after TCR stimulation. Phosphorylated by Src-family kinases following antigen receptor activation. Plays a role in lymphocyte activation.

Protein type: Kinase, protein; Protein kinase, tyrosine (non-receptor); EC 2.7.10.2; Protein kinase, TK; TK group; Syk family

Cellular Component: T cell receptor complex; extrinsic to internal side of plasma membrane; membrane; cytoplasm; plasma membrane; immunological synapse; intracellular; intercellular junction; cytosol; lipid raft

Molecular Function: transferase activity; protein binding; phosphotyrosine binding; protein-tyrosine kinase activity; transferase activity, transferring phosphorus-containing groups; nucleotide binding; non-membrane spanning protein tyrosine kinase activity; kinase activity; ATP binding; receptor binding; protein kinase activity

Biological Process: thymic T cell selection; cell migration; peptidyl-tyrosine phosphorylation; immune system process; protein amino acid autophosphorylation; positive regulation of calcium-mediated signaling; protein amino acid phosphorylation; T cell receptor signaling pathway; negative thymic T cell selection; positive regulation of T cell differentiation; innate immune response; positive regulation of alpha-beta T cell proliferation; immune response; beta selection; phosphorylation; transmembrane receptor protein tyrosine kinase signaling pathway; positive regulation of alpha-beta T cell differentiation; positive thymic T cell selection

Research Articles on ZAP70

Similar Products

Product Notes

The ZAP70 zap70 (Catalog #AAA3215118) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Zap70 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Zap70 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZAP70 zap70 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TDKPRPMPMD TSVYESPYSD PEELKDKKLF LKRENLLVAD IELGCGNFGS. It is sometimes possible for the material contained within the vial of "Zap70, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.