Western Blot (WB)
(Host: MouseTarget Name: YES1Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)
Rabbit anti-Human YES1 Polyclonal Antibody | anti-YES1 antibody
YES1 Antibody - C-terminal region
Gene Names
YES1; Yes; c-yes; HsT441; P61-YES
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
YES1; Polyclonal Antibody; YES1 Antibody - C-terminal region; anti-YES1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 23% sucrose.
Sequence
Synthetic peptide located within the following region: MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGT
Sequence Length
543
Applicable Applications for anti-YES1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human YES1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: MouseTarget Name: YES1Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: MouseTarget Name: YES1Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: YES1Sample Tissue: Human NCI-H226 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: YES1Sample Tissue: Human NCI-H226 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-YES1 antibody
This gene is the cellular homolog of the Yamaguchi sarcoma virus oncogene. The encoded protein has tyrosine kinase activity and belongs to the src family of proteins. This gene lies in close proximity to thymidylate synthase gene on chromosome 18, and a corresponding pseudogene has been found on chromosome 22.
Product Categories/Family for anti-YES1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59 kDa
NCBI Official Full Name
tyrosine-protein kinase Yes
NCBI Official Synonym Full Names
YES proto-oncogene 1, Src family tyrosine kinase
NCBI Official Symbol
YES1
NCBI Official Synonym Symbols
Yes; c-yes; HsT441; P61-YES
NCBI Protein Information
tyrosine-protein kinase Yes
UniProt Protein Name
Tyrosine-protein kinase Yes
Protein Family
UniProt Gene Name
YES1
UniProt Synonym Gene Names
YES
UniProt Entry Name
YES_HUMAN
NCBI Description
This gene is the cellular homolog of the Yamaguchi sarcoma virus oncogene. The encoded protein has tyrosine kinase activity and belongs to the src family of proteins. This gene lies in close proximity to thymidylate synthase gene on chromosome 18, and a corresponding pseudogene has been found on chromosome 22. [provided by RefSeq, Jul 2008]
Research Articles on YES1
Similar Products
Product Notes
The YES1 yes1 (Catalog #AAA3220806) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The YES1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's YES1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the YES1 yes1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MGCIKSKENK SPAIKYRPEN TPEPVSTSVS HYGAEPTTVS PCPSSSAKGT. It is sometimes possible for the material contained within the vial of "YES1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
