Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-XTP3TPA Antibody Titration: 0.5ug/mlPositive Control: Transfected 293T)

Rabbit anti-Human XTP3TPA Polyclonal Antibody | anti-DCTPP1 antibody

XTP3TPA antibody - N-terminal region

Gene Names
DCTPP1; CDA03; RS21C6; XTP3TPA
Reactivity
Human
Applications
Western Blot
Purity
Protein A purified
Synonyms
XTP3TPA; Polyclonal Antibody; XTP3TPA antibody - N-terminal region; anti-DCTPP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQF
Sequence Length
170
Applicable Applications for anti-DCTPP1 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human XTP3TPA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-XTP3TPA Antibody Titration: 0.5ug/mlPositive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-XTP3TPA Antibody Titration: 0.5ug/mlPositive Control: Transfected 293T)
Related Product Information for anti-DCTPP1 antibody
This is a rabbit polyclonal antibody against XTP3TPA. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The function remains unknown.
Product Categories/Family for anti-DCTPP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
dCTP pyrophosphatase 1
NCBI Official Synonym Full Names
dCTP pyrophosphatase 1
NCBI Official Symbol
DCTPP1
NCBI Official Synonym Symbols
CDA03; RS21C6; XTP3TPA
NCBI Protein Information
dCTP pyrophosphatase 1
UniProt Protein Name
dCTP pyrophosphatase 1
Protein Family
UniProt Gene Name
DCTPP1
UniProt Synonym Gene Names
XTP3TPA; dCTPase 1
UniProt Entry Name
DCTP1_HUMAN

NCBI Description

The protein encoded by this gene is dCTP pyrophosphatase, which converts dCTP to dCMP and inorganic pyrophosphate. The encoded protein also displays weak activity against dTTP and dATP, but none against dGTP. This protein may be responsible for eliminating excess dCTP after DNA synthesis and may prevent overmethylation of CpG islands. Three transcript variants, one protein-coding and the other two non-protein coding, have been found for this gene. [provided by RefSeq, Dec 2015]

Uniprot Description

XTP3TPA: Hydrolyzes deoxynucleoside triphosphates (dNTPs) to the corresponding nucleoside monophosphates. Has a strong preference for modified dCTP. Activity is highest with 5-iodo-dCTP, followed by 5-bromo-dCTP, unmodified dCTP, 5-methyl-dCTP and 5-chloro-dCTP. Hydrolyzes 2-chloro-dATP and 2-hydroxy-dATP with lower efficiency, and has even lower activity with unmodified dATP, dTTP and dUTP (in vitro). Does not hydrolyze ATP, UTP, ITP, GTP, dADP, dCDP or dGTP. May protect DNA or RNA against the incorporation of non- canonical nucleotide triphosphates. May protect cells against inappropriate methylation of CpG islands by DNA methyltransferases.

Protein type: EC 3.6.1.12

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: cytosol

Molecular Function: dCTP diphosphatase activity; pyrimidine deoxyribonucleotide binding; magnesium ion binding; nucleoside-triphosphate diphosphatase activity

Biological Process: nucleoside triphosphate catabolic process; protein homotetramerization

Research Articles on DCTPP1

Similar Products

Product Notes

The DCTPP1 dctpp1 (Catalog #AAA3208160) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The XTP3TPA antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's XTP3TPA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DCTPP1 dctpp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSVAGGEIRG DTGGEDTAAP GRFSFSPEPT LEDIRRLHAE FAAERDWEQF. It is sometimes possible for the material contained within the vial of "XTP3TPA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.