Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (XPA rabbit polyclonal antibody. Western Blot analysis of XPA expression in mouse kidney.)

Rabbit anti-Human, Mouse XPA Polyclonal Antibody | anti-XPA antibody

XPA (Xeroderma Pigmentosum Group A-complementing Protein, XPAC, DNA Repair Protein Complementing XP-A Cells, XP1) (PE)

Gene Names
XPA; XP1; XPAC
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
XPA; Polyclonal Antibody; XPA (Xeroderma Pigmentosum Group A-complementing Protein; XPAC; DNA Repair Protein Complementing XP-A Cells; XP1) (PE); anti-XPA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human XPA. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-XPA antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human XPA, aa1-273 (NP_000371.1).
Immunogen Sequence
MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(XPA rabbit polyclonal antibody. Western Blot analysis of XPA expression in mouse kidney.)

Western Blot (WB) (XPA rabbit polyclonal antibody. Western Blot analysis of XPA expression in mouse kidney.)

Western Blot (WB)

(Western Blot analysis of XPA expression in transfected 293T cell line by XPA polyclonal antibody. Lane 1: XPA transfected lysate (31.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of XPA expression in transfected 293T cell line by XPA polyclonal antibody. Lane 1: XPA transfected lysate (31.4kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-XPA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,368 Da
NCBI Official Full Name
DNA repair protein complementing XP-A cells
NCBI Official Synonym Full Names
xeroderma pigmentosum, complementation group A
NCBI Official Symbol
XPA
NCBI Official Synonym Symbols
XP1; XPAC
NCBI Protein Information
DNA repair protein complementing XP-A cells; excision repair-controlling; xeroderma pigmentosum group A-complementing protein
UniProt Protein Name
DNA repair protein complementing XP-A cells
Protein Family
UniProt Gene Name
XPA
UniProt Synonym Gene Names
XPAC
UniProt Entry Name
XPA_HUMAN

NCBI Description

This gene encodes a zinc finger protein involved in DNA excision repair. The encoded protein is part of the NER (nucleotide excision repair) complext which is responsible for repair of UV radiation-induced photoproducts and DNA adducts induced by chemical carcinogens. Mutations in this gene are associated with xeroderma pigmentosum complementation group A. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2009]

Uniprot Description

XPA: Involved in DNA excision repair. Initiates repair by binding to damaged sites with various affinities, depending on the photoproduct and the transcriptional state of the region. Required for UV-induced CHEK1 phosphorylation and the recruitment of CEP164 to cyclobutane pyrimidine dimmers (CPD), sites of DNA damage after UV irradiation. Interacts with GPN1 and RPA1. Interacts (via N-terminus) with CEP164 upon UV irradiation. Interacts with HERC2. Expressed in various cell lines and in skin fibroblasts. Belongs to the XPA family.

Protein type: DNA repair, damage

Chromosomal Location of Human Ortholog: 9q22.3

Cellular Component: nucleoplasm; Golgi apparatus; intercellular bridge; DNA replication factor A complex; cytoplasm; nucleus

Molecular Function: protein domain specific binding; protein binding; protein homodimerization activity; metal ion binding; damaged DNA binding

Biological Process: DNA damage response, signal transduction resulting in induction of apoptosis; nucleotide-excision repair; response to toxin; multicellular organism growth; nucleotide-excision repair, DNA damage removal; response to oxidative stress; DNA repair; response to UV

Disease: Xeroderma Pigmentosum, Complementation Group A

Research Articles on XPA

Similar Products

Product Notes

The XPA xpa (Catalog #AAA6398754) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The XPA (Xeroderma Pigmentosum Group A-complementing Protein, XPAC, DNA Repair Protein Complementing XP-A Cells, XP1) (PE) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's XPA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the XPA xpa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "XPA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.