Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: XIAPSample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

Rabbit anti-Human XIAP Polyclonal Antibody | anti-XIAP antibody

XIAP Antibody - middle region

Gene Names
XIAP; API3; ILP1; MIHA; XLP2; BIRC4; IAP-3; hIAP3; hIAP-3
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
XIAP; Polyclonal Antibody; XIAP Antibody - middle region; anti-XIAP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLV
Sequence Length
497
Applicable Applications for anti-XIAP antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human XIAP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: XIAPSample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: XIAPSample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: XIAPSample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: XIAPSample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-XIAP antibody
This gene encodes a protein that belongs to a family of apoptotic suppressor proteins. Members of this family share a conserved motif termed, baculovirus IAP repeat, which is necessary for their anti-apoptotic function. This protein functions through binding to tumor necrosis factor receptor-associated factors TRAF1 and TRAF2 and inhibits apoptosis induced by menadione, a potent inducer of free radicals, and interleukin 1-beta converting enzyme. This protein also inhibits at least two members of the caspase family of cell-death proteases, caspase-3 and caspase-7. Mutations in this gene are the cause of X-linked lymphoproliferative syndrome. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 2 and 11.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
331
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54 kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase XIAP
NCBI Official Synonym Full Names
X-linked inhibitor of apoptosis
NCBI Official Symbol
XIAP
NCBI Official Synonym Symbols
API3; ILP1; MIHA; XLP2; BIRC4; IAP-3; hIAP3; hIAP-3
NCBI Protein Information
E3 ubiquitin-protein ligase XIAP
UniProt Protein Name
E3 ubiquitin-protein ligase XIAP
Protein Family
UniProt Gene Name
XIAP
UniProt Synonym Gene Names
API3; BIRC4; IAP3; ILP; hILP; IAP-3; hIAP-3; hIAP3
UniProt Entry Name
XIAP_HUMAN

NCBI Description

This gene encodes a protein that belongs to a family of apoptotic suppressor proteins. Members of this family share a conserved motif termed, baculovirus IAP repeat, which is necessary for their anti-apoptotic function. This protein functions through binding to tumor necrosis factor receptor-associated factors TRAF1 and TRAF2 and inhibits apoptosis induced by menadione, a potent inducer of free radicals, and interleukin 1-beta converting enzyme. This protein also inhibits at least two members of the caspase family of cell-death proteases, caspase-3 and caspase-7. Mutations in this gene are the cause of X-linked lymphoproliferative syndrome. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 2 and 11.[provided by RefSeq, Feb 2011]

Uniprot Description

XIAP: an apoptotic suppressor protein. Inhibist apoptosis through binding to tumor necrosis factor receptor-associated factors TRAF1 and TRAF2. Inhibits apoptosis induced by menadione, a potent inducer of free radicals, and ICE. Inhibits cell-death proteases, caspase-3, caspase-7, and perhaps caspase-9.

Protein type: Ligase; Ubiquitin conjugating system; Ubiquitin ligase; EC 6.3.2.-; Apoptosis

Chromosomal Location of Human Ortholog: Xq25

Cellular Component: nucleoplasm; spindle microtubule; cytoplasm; nucleus; cytosol

Molecular Function: protein binding; zinc ion binding; caspase inhibitor activity; ubiquitin-protein ligase activity; ligase activity

Biological Process: Wnt receptor signaling pathway; positive regulation of protein ubiquitination; apoptosis; regulation of inflammatory response; regulation of BMP signaling pathway; protein ubiquitination; negative regulation of caspase activity; response to DNA damage stimulus; copper ion homeostasis; regulation of innate immune response; negative regulation of apoptosis; regulation of cell proliferation

Disease: Lymphoproliferative Syndrome, X-linked, 1; Lymphoproliferative Syndrome, X-linked, 2

Research Articles on XIAP

Similar Products

Product Notes

The XIAP xiap (Catalog #AAA3221049) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The XIAP Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's XIAP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the XIAP xiap for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GGGLTDWKPS EDPWEQHAKW YPGCKYLLEQ KGQEYINNIH LTHSLEECLV. It is sometimes possible for the material contained within the vial of "XIAP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.