Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: WDR82Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human WDR82 Polyclonal Antibody | anti-WDR82 antibody

WDR82 Antibody - N-terminal region

Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
WDR82; Polyclonal Antibody; WDR82 Antibody - N-terminal region; anti-WDR82 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDN
Sequence Length
313
Applicable Applications for anti-WDR82 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human WDR82
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: WDR82Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: WDR82Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-WDR82 antibody
This is a rabbit polyclonal antibody against WDR82. It was validated on Western Blot

Target Description: TMEM113 (WDR82) is a component of the mammalian SET1A (MIM 611052)/SET1B (MIM 611055) histone H3-Lys4 methyltransferase complexes.
Product Categories/Family for anti-WDR82 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
UniProt Protein Name
WD repeat-containing protein 82
UniProt Gene Name
WDR82
UniProt Synonym Gene Names
TMEM113; WDR82A
UniProt Entry Name
WDR82_HUMAN

Uniprot Description

WDR82: a WD repeat-containing protein. A regulatory component of the histone H3K4 methylatransferase SET1 complex implicated in tethering this complex to transcriptional start sites of active genes. Facilitates histone H3K4 methylation via recruitment of the SETD1A or SETD1B to phospho-S5 in the C-terminal domain (CTD) of RNA polymerase II large subunit (POLR2A). Component of PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase. Component of the SET1 complex, composed of at least the catalytic subunit (SETD1A or SETD1B), WDR5, WDR82, RBBP5, ASH2L/ASH2, CXXC1/CFP1, HCFC1 and DPY30. Component of the PTW/PP1 phosphatase complex, composed of PPP1R10/PNUTS, TOX4, WDR82, and PPP1CA, ¿B, or -C. Associated with multiple protein complexes including an RNA polymerase II complex, MLL3/MLL4 complex and a chaperonin-containing TCP1 complex. Interacts with CUL4B. Interacts with RBBP5 and SETD1B. Interacts with SETD1A (via RRM domain). Interacts with POLR2B. Interacts with hyperphosphorylated C-terminal domain (CTD) of RNA polymerase II large subunit (POLR2A). SETD1A enhances its interaction with POLR2A. Interacts with PPP1R10/PNUTS. Interacts with PPP1CA in the presence of PPP1R10/PNUTS.

Protein type: Methyltransferase

Chromosomal Location of Human Ortholog: 3p21.2

Cellular Component: histone methyltransferase complex; chromatin

Molecular Function: protein binding; histone lysine N-methyltransferase activity (H3-K4 specific); chromatin binding

Biological Process: histone H3-K4 methylation

Similar Products

Product Notes

The WDR82 wdr82 (Catalog #AAA3220122) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WDR82 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's WDR82 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the WDR82 wdr82 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YDCQEGKPKR TLYSKKYGVD LIRYTHAANT VVYSSNKIDD TIRYLSLHDN. It is sometimes possible for the material contained within the vial of "WDR82, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.