Western Blot (WB)
(WB Suggested Anti-WDR8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Thymus)
Rabbit WDR8 Polyclonal Antibody | anti-WRAP73 antibody
WDR8 antibody - middle region
Gene Names
WRAP73; WDR8
Reactivity
Cow, Horse, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
WDR8; Polyclonal Antibody; WDR8 antibody - middle region; anti-WRAP73 antibody
Host
Rabbit
Reactivity
Cow, Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GCLSFPPPRAGAGPLPSSESKYEIASVPVSLQTLKPVTDRANPKMGIGML
Sequence Length
460
Applicable Applications for anti-WRAP73 antibody
Western Blot (WB)
Homology
Cow: 79%; Horse: 79%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human WDR8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-WDR8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Thymus)
Western Blot (WB)
(WB Suggested Anti-WDR8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Thymus)
Related Product Information for anti-WRAP73 antibody
This is a rabbit polyclonal antibody against WDR8. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein com
Target Description: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein com
Product Categories/Family for anti-WRAP73 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
WD repeat-containing protein WRAP73
NCBI Official Synonym Full Names
WD repeat containing, antisense to TP73
NCBI Official Symbol
WRAP73
NCBI Official Synonym Symbols
WDR8
NCBI Protein Information
WD repeat-containing protein WRAP73
UniProt Protein Name
WD repeat-containing protein WRAP73
Protein Family
UniProt Gene Name
WRAP73
UniProt Synonym Gene Names
WDR8
UniProt Entry Name
WRP73_HUMAN
NCBI Description
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Studies of the related mouse protein suggest that the encoded protein may play a role in the process of ossification. [provided by RefSeq, Mar 2009]
Research Articles on WRAP73
Similar Products
Product Notes
The WRAP73 wrap73 (Catalog #AAA3205772) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WDR8 antibody - middle region reacts with Cow, Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's WDR8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the WRAP73 wrap73 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GCLSFPPPRA GAGPLPSSES KYEIASVPVS LQTLKPVTDR ANPKMGIGML. It is sometimes possible for the material contained within the vial of "WDR8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
