Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-WDR35 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)

Rabbit WDR35 Polyclonal Antibody | anti-WDR35 antibody

WDR35 antibody - N-terminal region

Gene Names
WDR35; CED2; IFTA1; SRTD7; IFT121
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
WDR35; Polyclonal Antibody; WDR35 antibody - N-terminal region; anti-WDR35 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SGSVQVVTWNEQYQKLTTSDENGLIIVWMLYKGSWIEEMINNRNKSVVRS
Sequence Length
1170
Applicable Applications for anti-WDR35 antibody
Western Blot (WB)
Homology
Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human WDR35
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-WDR35 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)

Western Blot (WB) (WB Suggested Anti-WDR35 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)
Related Product Information for anti-WDR35 antibody
This is a rabbit polyclonal antibody against WDR35. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene, but the biological validity of some variants has not been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
132kDa
NCBI Official Full Name
WD repeat-containing protein 35 isoform 2
NCBI Official Synonym Full Names
WD repeat domain 35
NCBI Official Symbol
WDR35
NCBI Official Synonym Symbols
CED2; IFTA1; SRTD7; IFT121
NCBI Protein Information
WD repeat-containing protein 35
UniProt Protein Name
WD repeat-containing protein 35
UniProt Gene Name
WDR35
UniProt Synonym Gene Names
IFT121; KIAA1336
UniProt Entry Name
WDR35_HUMAN

NCBI Description

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. Two patients with Sensenbrenner syndrome / cranioectodermal dysplasia (CED) were identified with mutations in this gene, consistent with a possible ciliary function.[provided by RefSeq, Sep 2010]

Uniprot Description

WDR35: a WD40 repeat protein. WD40 repeats are found in a number of eukaryotic proteins that coordinate multi-protein complex assemblies. WD40 proteins are implicated in many functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly. Two alternatively spliced human isoforms have been described.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 2p24.1

Cellular Component: centrosome; axoneme

Biological Process: organelle organization and biogenesis; cilium biogenesis

Disease: Cranioectodermal Dysplasia 2; Short-rib Thoracic Dysplasia 7 With Or Without Polydactyly

Research Articles on WDR35

Similar Products

Product Notes

The WDR35 wdr35 (Catalog #AAA3213368) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WDR35 antibody - N-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's WDR35 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the WDR35 wdr35 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SGSVQVVTWN EQYQKLTTSD ENGLIIVWML YKGSWIEEMI NNRNKSVVRS. It is sometimes possible for the material contained within the vial of "WDR35, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.