Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WDR61 rabbit polyclonal antibody. Western Blot analysis of WDR61 expression in mouse brain.)

Rabbit anti-Human, Mouse WDR61 Polyclonal Antibody | anti-WDR61 antibody

WDR61 (WD Repeat-containing Protein 61, Meiotic Recombination REC14 Protein Homolog, SKI8 Homolog, Ski8) (AP)

Gene Names
WDR61; SKI8; REC14
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
WDR61; Polyclonal Antibody; WDR61 (WD Repeat-containing Protein 61; Meiotic Recombination REC14 Protein Homolog; SKI8 Homolog; Ski8) (AP); anti-WDR61 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human WDR61. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-WDR61 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human WDR61, aa1-305 (NP_079510.1).
Immunogen Sequence
MTNQYGILFKQEQAHDDAIWSVAWGTNKKENSETVVTGSLDDLVKVWKWRDERLDLQWSLEGHQLGVVSVDISHTLPIAASSSLDAHIRLWDLENGKQIKSIDAGPVDAWTLAFSPDSQYLATGTHVGKVNIFGVESGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANLAGTLSGHASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTRTCVHTFFDHQDQVWGVKYNGNGSKIVSVGDDQEIHIYDCPI
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(WDR61 rabbit polyclonal antibody. Western Blot analysis of WDR61 expression in mouse brain.)

Western Blot (WB) (WDR61 rabbit polyclonal antibody. Western Blot analysis of WDR61 expression in mouse brain.)

Western Blot (WB)

(Western Blot analysis of WDR61 expression in transfected 293T cell line by WDR61 polyclonal antibody. Lane 1: WDR61 transfected lysate (33.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of WDR61 expression in transfected 293T cell line by WDR61 polyclonal antibody. Lane 1: WDR61 transfected lysate (33.6kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-WDR61 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,581 Da
NCBI Official Full Name
WD repeat-containing protein 61 isoform a
NCBI Official Synonym Full Names
WD repeat domain 61
NCBI Official Symbol
WDR61
NCBI Official Synonym Symbols
SKI8; REC14
NCBI Protein Information
WD repeat-containing protein 61
UniProt Protein Name
WD repeat-containing protein 61
UniProt Gene Name
WDR61
UniProt Synonym Gene Names
Ski8
UniProt Entry Name
WDR61_HUMAN

NCBI Description

WDR61 is a subunit of the human PAF and SKI complexes, which function in transcriptional regulation and are involved in events downstream of RNA synthesis, such as RNA surveillance (Zhu et al., 2005 [PubMed 16024656]).[supplied by OMIM, Mar 2008]

Uniprot Description

WDR61: Component of the PAF1 complex (PAF1C) which has multiple functions during transcription by RNA polymerase II and is implicated in regulation of development and maintenance of embryonic stem cell pluripotency. PAF1C associates with RNA polymerase II through interaction with POLR2A CTD non- phosphorylated and 'Ser-2'- and 'Ser-5'-phosphorylated forms and is involved in transcriptional elongation, acting both indepentently and synergistically with TCEA1 and in cooperation with the DSIF complex and HTATSF1. PAF1C is required for transcription of Hox and Wnt target genes. PAF1C is involved in hematopoiesis and stimulates transcriptional activity of MLL1; it promotes leukemogenesis though association with MLL-rearranged oncoproteins, such as MLL-MLLT3/AF9 and MLL-MLLT1/ENL. PAF1C is involved in histone modifications such as ubiquitination of histone H2B and methylation on histone H3 'Lys-4' (H3K4me3). PAF1C recruits the RNF20/40 E3 ubiquitin-protein ligase complex and the E2 enzyme UBE2A or UBE2B to chromatin which mediate monoubiquitination of 'Lys-120' of histone H2B (H2BK120ub1); UB2A/B-mediated H2B ubiquitination is proposed to be coupled to transcription. PAF1C is involved in mRNA 3' end formation probably through association with cleavage and poly(A) factors. In case of infection by influenza A strain H3N2, PAF1C associates with viral NS1 protein, thereby regulating gene transcription. Required for mono- and trimethylation on histone H3 'Lys-4' (H3K4me3), dimethylation on histone H3 'Lys-79' (H3K4me3). Required for Hox gene transcription. Component of the SKI complex which is thought to be involved in exosome-mediated RNA decay and associates with transcriptionally active genes in a manner dependent on PAF1C.

Chromosomal Location of Human Ortholog: 15q25.1

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: protein binding

Biological Process: Wnt receptor signaling pathway; negative regulation of myeloid cell differentiation; transcription, DNA-dependent; positive regulation of RNA elongation from RNA polymerase II promoter; positive regulation of transcription from RNA polymerase II promoter; positive regulation of histone H3-K4 methylation

Similar Products

Product Notes

The WDR61 wdr61 (Catalog #AAA6398513) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WDR61 (WD Repeat-containing Protein 61, Meiotic Recombination REC14 Protein Homolog, SKI8 Homolog, Ski8) (AP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's WDR61 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the WDR61 wdr61 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "WDR61, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.