Western Blot (WB)
(Host: RabbitTarget Name: NIPAL4Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human NIPAL4 Polyclonal Antibody | anti-NIPAL4 antibody
NIPAL4 Antibody - N-terminal region
Gene Names
NIPAL4; ARCI6; ICHYN; ICHTHYIN
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NIPAL4; Polyclonal Antibody; NIPAL4 Antibody - N-terminal region; anti-NIPAL4 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LGPDPGGFSRASHAGDKSRPPAPELGSPGAVRPRVGSCAPGPMELRVSNT
Sequence Length
447
Applicable Applications for anti-NIPAL4 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human NIPAL4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: NIPAL4Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: NIPAL4Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-NIPAL4 antibody
This is a rabbit polyclonal antibody against NIPAL4. It was validated on Western Blot
Target Description: This gene likely encodes a membrane receptor. Mutations in this gene have been associated with autosomal recessive congenital ichthyosis.
Target Description: This gene likely encodes a membrane receptor. Mutations in this gene have been associated with autosomal recessive congenital ichthyosis.
Product Categories/Family for anti-NIPAL4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
magnesium transporter NIPA4 isoform 2
NCBI Official Synonym Full Names
NIPA like domain containing 4
NCBI Official Symbol
NIPAL4
NCBI Official Synonym Symbols
ARCI6; ICHYN; ICHTHYIN
NCBI Protein Information
magnesium transporter NIPA4
UniProt Protein Name
Magnesium transporter NIPA4
Protein Family
UniProt Gene Name
NIPAL4
UniProt Synonym Gene Names
ICHN; NIPA4
UniProt Entry Name
NIPA4_HUMAN
NCBI Description
This gene likely encodes a membrane receptor. Mutations in this gene have been associated with autosomal recessive congenital ichthyosis. [provided by RefSeq, Feb 2010]
Research Articles on NIPAL4
Similar Products
NIPA4 Antibody
Host: Rabbit
Reactivity: Human, Mouse
Apps: Immunohistochemistry, ELISA, Western Blot
NIPA4 Antibody
Host: Rabbit
Reactivity: Human, Mouse
Apps: Immunohistochemistry, ELISA, Western Blot
Product Notes
The NIPAL4 nipal4 (Catalog #AAA3217582) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NIPAL4 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NIPAL4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NIPAL4 nipal4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LGPDPGGFSR ASHAGDKSRP PAPELGSPGA VRPRVGSCAP GPMELRVSNT. It is sometimes possible for the material contained within the vial of "NIPAL4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
