Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-VTA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Rabbit VTA1 Polyclonal Antibody | anti-VTA1 antibody

VTA1 antibody - N-terminal region

Gene Names
VTA1; DRG1; LIP5; SBP1; DRG-1; My012; C6orf55; HSPC228
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
VTA1; Polyclonal Antibody; VTA1 antibody - N-terminal region; anti-VTA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYT
Sequence Length
307
Applicable Applications for anti-VTA1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human VTA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-VTA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-VTA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)
Related Product Information for anti-VTA1 antibody
This is a rabbit polyclonal antibody against VTA1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: C6ORF55 encodes a protein involved in trafficking of the multivesicular body, an endosomal compartment involved in sorting membrane proteins for degradation in lysosomes (Ward et al., 2005 [PubMed 15644320]).
Product Categories/Family for anti-VTA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
vacuolar protein sorting-associated protein VTA1 homolog isoform a
NCBI Official Synonym Full Names
vesicle trafficking 1
NCBI Official Symbol
VTA1
NCBI Official Synonym Symbols
DRG1; LIP5; SBP1; DRG-1; My012; C6orf55; HSPC228
NCBI Protein Information
vacuolar protein sorting-associated protein VTA1 homolog
UniProt Protein Name
Vacuolar protein sorting-associated protein VTA1 homolog
UniProt Gene Name
VTA1
UniProt Synonym Gene Names
C6orf55; DRG-1; LIP5; SBP1
UniProt Entry Name
VTA1_HUMAN

NCBI Description

C6ORF55 encodes a protein involved in trafficking of the multivesicular body, an endosomal compartment involved in sorting membrane proteins for degradation in lysosomes (Ward et al., 2005 [PubMed 15644320]).[supplied by OMIM, Mar 2008]

Uniprot Description

VTA1: Involved in the endosomal multivesicular bodies (MVB) pathway. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. Thought to be a cofactor of VPS4A/B, which catalyzes disassembles membrane-associated ESCRT-III assemblies. Involved in the sorting and down-regulation of EGFR. Involved in HIV-1 budding. Belongs to the VTA1 family.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 6q24.1

Cellular Component: endosome membrane; cytosol

Molecular Function: protein binding

Biological Process: protein transport; viral reproduction; viral infectious cycle; endosome transport

Research Articles on VTA1

Similar Products

Product Notes

The VTA1 vta1 (Catalog #AAA3213077) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VTA1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's VTA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the VTA1 vta1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KKQLGDNEAI TQEIVGCAHL ENYALKMFLY ADNEDRAGRF HKNMIKSFYT. It is sometimes possible for the material contained within the vial of "VTA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.