Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: VSX1Sample Type: Human 293TAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human VSX1 Polyclonal Antibody | anti-VSX1 antibody

VSX1 antibody - middle region

Gene Names
VSX1; PPD; KTCN; PPCD; RINX; KTCN1; PPCD1; CAASDS
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
VSX1; Polyclonal Antibody; VSX1 antibody - middle region; anti-VSX1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LAGLWGSDHFKEGSSQSESGSQRGSDKVSPENGLEDVAIDLSSSARQETK
Sequence Length
365
Applicable Applications for anti-VSX1 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human VSX1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: VSX1Sample Type: Human 293TAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: VSX1Sample Type: Human 293TAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: VSX1Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlVSX1 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (Host: RabbitTarget Name: VSX1Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlVSX1 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB)

(WB Suggested Anti-VSX1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-VSX1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Liver)
Related Product Information for anti-VSX1 antibody
This is a rabbit polyclonal antibody against VSX1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: VSX1 contains a paired-like homeodomain and binds to the core of the locus control region of the red/green visual pigment gene cluster. VSX1 may regulate expression of the cone opsin genes early in development. Mutations in VSX1 can cause posterior polymorphous corneal dystrophy and keratoconus. Alternatively spliced transcript variants encoding different isoforms have been described.The protein encoded by this gene contains a paired-like homeodomain and binds to the core of the locus control region of the red/green visual pigment gene cluster. The encoded protein may regulate expression of the cone opsin genes early in development. Mutations in this gene can cause posterior polymorphous corneal dystrophy and keratoconus. Alternatively spliced transcript variants encoding different isoforms have been described.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
visual system homeobox 1 isoform a
NCBI Official Synonym Full Names
visual system homeobox 1
NCBI Official Symbol
VSX1
NCBI Official Synonym Symbols
PPD; KTCN; PPCD; RINX; KTCN1; PPCD1; CAASDS
NCBI Protein Information
visual system homeobox 1
UniProt Protein Name
Visual system homeobox 1
Protein Family
UniProt Gene Name
VSX1
UniProt Synonym Gene Names
RINX
UniProt Entry Name
VSX1_HUMAN

NCBI Description

The protein encoded by this gene contains a paired-like homeodomain and binds to the core of the locus control region of the red/green visual pigment gene cluster. The encoded protein may regulate expression of the cone opsin genes early in development. Mutations in this gene can cause posterior polymorphous corneal dystrophy and keratoconus. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

VSX1: Binds to the 37-bp core of the locus control region (LCR) of the red/green visual pigment gene cluster. May regulate the activity of the LCR and the cone opsin genes at earlier stages of development. Defects in VSX1 are a cause of posterior polymorphous corneal dystrophy type 1 (PPCD1). PPCD1 is a slowly progressive hereditary disorder of the corneal endothelium that leads to a variable degree of visual impairment usually in adulthood. Defects in VSX1 are a cause of keratoconus type 1 (KTCN1). Keratoconus type 1 is a frequent corneal dystrophy with an incidence that varies from 50 to 230 per 100'000. The cornea assumes a conical shape as a result of a progressive non- inflammatory thinning of the corneal stroma. Keratoconus is most often an isolated sporadic condition with cases of autosomal dominant and autosomal recessive transmission. Defects in VSX1 are the cause of craniofacial anomalies and anterior segment dysgenesis syndrome (CAASDS). CAASDS is a disorder with extremely variable expressivity. Clinical features include wide interpupillary distance, abnormal corneal endothelium, unusual pinnae, partially to completely empty sella turcica, posterior fossa cyst, anterior encephalocele, and/or hydrocephalus. Belongs to the paired homeobox family. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell development/differentiation; DNA-binding

Chromosomal Location of Human Ortholog: 20p11.21

Cellular Component: nucleus

Molecular Function: sequence-specific DNA binding; transcription factor activity

Biological Process: transcription, DNA-dependent; visual perception; regulation of transcription, DNA-dependent; response to stimulus; neuron maturation; retinal bipolar neuron differentiation

Disease: Corneal Dystrophy, Posterior Polymorphous, 1; Keratoconus 1; Craniofacial Anomalies And Anterior Segment Dysgenesis Syndrome

Research Articles on VSX1

Similar Products

Product Notes

The VSX1 vsx1 (Catalog #AAA3202815) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VSX1 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's VSX1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the VSX1 vsx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LAGLWGSDHF KEGSSQSESG SQRGSDKVSP ENGLEDVAID LSSSARQETK. It is sometimes possible for the material contained within the vial of "VSX1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.