Mouse anti-Human DST Monoclonal Antibody | anti-DST antibody

DST (Dystonin, 230kD Bullous Pemphigoid Antigen, 230/240kD Bullous Pemphigoid Antigen, Bullous Pemphigoid Antigen 1, BPA, Bullous Pemphigoid Antigen, Dystonia Musculorum Protein, Hemidesmosomal Plaque Protein, BP230, BP240, BPAG1, DMH, DT, KIAA0728) (HRP)

Cat. Num. AAA6152221

• Gene Names: DST; DT; BPA; DMH; BP240; BPAG1; EBSB2; HSAN6; MACF2; CATX15; CATX-15; D6S1101
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DST; Monoclonal Antibody; DST (Dystonin; 230kD Bullous Pemphigoid Antigen; 230/240kD Bullous Pemphigoid Antigen; Bullous Pemphigoid Antigen 1; BPA; Bullous Pemphigoid Antigen; Dystonia Musculorum Protein; Hemidesmosomal Plaque Protein; BP230; BP240; BPAG1; DMH; DT; KIAA0728) (HRP); anti-DST antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1B10
• Specificity: Recognizes human DST.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 5497

• Applicable Applications for anti-DST antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa401-500 from human DST (NP_899236) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EDKLILAGNALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMIS
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to DST on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged DST is ~0.1ng/ml as a capture antibody)

Product Categories/Family for anti-DST antibody

Antibodies; Actin

References

1. Dystonin/Bpag1 is a necessary endoplasmic reticulum/nuclear envelope protein in sensory neurons. Young KG, Kothary R.Exp Cell Res. 2008 Sep 10;314(15):2750-61. Epub 2008 Jul 3.

NCBI and Uniprot Product Information

• NCBI GI #: 34577047
• NCBI GeneID: 667
• NCBI Accession #: NP_899236
• NCBI GenBank Nucleotide #: NM_183380
• UniProt Accession #: Q03001
• NCBI Official Full Name: dystonin isoform 1
• NCBI Official Synonym Full Names: dystonin
• NCBI Official Symbol: DST
• NCBI Official Synonym Symbols: DT; BPA; DMH; BP240; BPAG1; EBSB2; HSAN6; MACF2; CATX15; CATX-15; D6S1101
• NCBI Protein Information: dystonin
• UniProt Protein Name: Dystonin
• Protein Family: Dystonin
• UniProt Gene Name: DST
• UniProt Synonym Gene Names: BP230; BP240; BPAG1; DMH; DT; KIAA0728; BPA; Bullous pemphigoid antigen
• UniProt Entry Name: DYST_HUMAN

NCBI Description

This gene encodes a member of the plakin protein family of adhesion junction plaque proteins. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene, but the full-length nature of some variants has not been defined. It has been reported that some isoforms are expressed in neural and muscle tissue, anchoring neural intermediate filaments to the actin cytoskeleton, and some isoforms are expressed in epithelial tissue, anchoring keratin-containing intermediate filaments to hemidesmosomes. Consistent with the expression, mice defective for this gene show skin blistering and neurodegeneration. [provided by RefSeq, Mar 2010]

Uniprot Description

BPAG1 iso3: a protein of the plakin family. Plakins are multi-domain proteins that have been shown to interact with microtubules, actin filaments and intermediate filaments, as well as proteins found in cellular junctions. Ten alternatively spliced human isoforms have been reported. BPAG1 has neuronal and muscle isoforms that consist of actin-binding and microtubule-binding domains at either end separated by a plakin domain and many spectrin repeats. Bpag1 isoforms with different N-termini may have differing roles. The plakin domain contains an apparent nuclear localization signal.

Protein type: Microtubule-binding; Cytoskeletal; Motility/polarity/chemotaxis; Actin-binding

Chromosomal Location of Human Ortholog: 6p12.1

Cellular Component: endoplasmic reticulum membrane; intermediate filament cytoskeleton; focal adhesion; cytoplasmic membrane-bound vesicle; leading edge; integral to membrane; intermediate filament; nuclear envelope; cell cortex; Z disc; cytosol; actin cytoskeleton; microtubule cytoskeleton; hemidesmosome; axon; cytoplasm; basal plasma membrane; basement membrane; nucleus

Molecular Function: protein C-terminus binding; integrin binding; microtubule plus-end binding; protein binding; protein homodimerization activity; calcium ion binding; actin binding

Biological Process: integrin-mediated signaling pathway; hemidesmosome assembly; extracellular matrix organization and biogenesis; cell motility involved in cell locomotion; response to wounding; intermediate filament cytoskeleton organization and biogenesis; cytoskeleton organization and biogenesis; microtubule cytoskeleton organization and biogenesis; cell cycle arrest; cell adhesion; maintenance of cell polarity