Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human DST Monoclonal Antibody | anti-DST antibody

DST (Dystonin, 230kD Bullous Pemphigoid Antigen, 230/240kD Bullous Pemphigoid Antigen, Bullous Pemphigoid Antigen 1, BPA, Bullous Pemphigoid Antigen, Dystonia Musculorum Protein, Hemidesmosomal Plaque Protein, BP230, BP240, BPAG1, DMH, DT, KIAA0728) (HRP)

Gene Names
DST; DT; BPA; DMH; BP240; BPAG1; EBSB2; HSAN6; MACF2; CATX15; CATX-15; D6S1101
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DST; Monoclonal Antibody; DST (Dystonin; 230kD Bullous Pemphigoid Antigen; 230/240kD Bullous Pemphigoid Antigen; Bullous Pemphigoid Antigen 1; BPA; Bullous Pemphigoid Antigen; Dystonia Musculorum Protein; Hemidesmosomal Plaque Protein; BP230; BP240; BPAG1; DMH; DT; KIAA0728) (HRP); anti-DST antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1B10
Specificity
Recognizes human DST.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
5497
Applicable Applications for anti-DST antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa401-500 from human DST (NP_899236) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EDKLILAGNALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMIS
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to DST on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to DST on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged DST is ~0.1ng/ml as a capture antibody)

Testing Data (Detection limit for recombinant GST tagged DST is ~0.1ng/ml as a capture antibody)
Product Categories/Family for anti-DST antibody
References
1. Dystonin/Bpag1 is a necessary endoplasmic reticulum/nuclear envelope protein in sensory neurons. Young KG, Kothary R.Exp Cell Res. 2008 Sep 10;314(15):2750-61. Epub 2008 Jul 3.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
667
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
dystonin isoform 1
NCBI Official Synonym Full Names
dystonin
NCBI Official Symbol
DST
NCBI Official Synonym Symbols
DT; BPA; DMH; BP240; BPAG1; EBSB2; HSAN6; MACF2; CATX15; CATX-15; D6S1101
NCBI Protein Information
dystonin
UniProt Protein Name
Dystonin
Protein Family
UniProt Gene Name
DST
UniProt Synonym Gene Names
BP230; BP240; BPAG1; DMH; DT; KIAA0728; BPA; Bullous pemphigoid antigen
UniProt Entry Name
DYST_HUMAN

NCBI Description

This gene encodes a member of the plakin protein family of adhesion junction plaque proteins. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene, but the full-length nature of some variants has not been defined. It has been reported that some isoforms are expressed in neural and muscle tissue, anchoring neural intermediate filaments to the actin cytoskeleton, and some isoforms are expressed in epithelial tissue, anchoring keratin-containing intermediate filaments to hemidesmosomes. Consistent with the expression, mice defective for this gene show skin blistering and neurodegeneration. [provided by RefSeq, Mar 2010]

Uniprot Description

BPAG1 iso3: a protein of the plakin family. Plakins are multi-domain proteins that have been shown to interact with microtubules, actin filaments and intermediate filaments, as well as proteins found in cellular junctions. Ten alternatively spliced human isoforms have been reported. BPAG1 has neuronal and muscle isoforms that consist of actin-binding and microtubule-binding domains at either end separated by a plakin domain and many spectrin repeats. Bpag1 isoforms with different N-termini may have differing roles. The plakin domain contains an apparent nuclear localization signal.

Protein type: Microtubule-binding; Cytoskeletal; Motility/polarity/chemotaxis; Actin-binding

Chromosomal Location of Human Ortholog: 6p12.1

Cellular Component: endoplasmic reticulum membrane; intermediate filament cytoskeleton; focal adhesion; cytoplasmic membrane-bound vesicle; leading edge; integral to membrane; intermediate filament; nuclear envelope; cell cortex; Z disc; cytosol; actin cytoskeleton; microtubule cytoskeleton; hemidesmosome; axon; cytoplasm; basal plasma membrane; basement membrane; nucleus

Molecular Function: protein C-terminus binding; integrin binding; microtubule plus-end binding; protein binding; protein homodimerization activity; calcium ion binding; actin binding

Biological Process: integrin-mediated signaling pathway; hemidesmosome assembly; extracellular matrix organization and biogenesis; cell motility involved in cell locomotion; response to wounding; intermediate filament cytoskeleton organization and biogenesis; cytoskeleton organization and biogenesis; microtubule cytoskeleton organization and biogenesis; cell cycle arrest; cell adhesion; maintenance of cell polarity

Research Articles on DST

Similar Products

Product Notes

The DST dst (Catalog #AAA6152221) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DST (Dystonin, 230kD Bullous Pemphigoid Antigen, 230/240kD Bullous Pemphigoid Antigen, Bullous Pemphigoid Antigen 1, BPA, Bullous Pemphigoid Antigen, Dystonia Musculorum Protein, Hemidesmosomal Plaque Protein, BP230, BP240, BPAG1, DMH, DT, KIAA0728) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DST can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DST dst for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DST, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.