Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human VPS36 Polyclonal Antibody | anti-VPS36 antibody

VPS36 Polyclonal Antibody

Gene Names
VPS36; EAP45; C13orf9; CGI-145
Reactivity
Human
Applications
Immunofluorescence
Purity
Affinity Purification
Synonyms
VPS36; Polyclonal Antibody; VPS36 Polyclonal Antibody; C13orf9; CGI-145; EAP45; anti-VPS36 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
EEQAAGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYRRLSEEMTQRRWENMPVSQSLQTNRGPQPGRIRAVGIVGIERKLEEKRKETDKNISEAFEDLSKLMIKAKEMVELSKSIANKIKDKQGDITEDETIRFKSY
Sequence Length
328
Applicable Applications for anti-VPS36 antibody
Immunofluorescence (IF)
Application Notes
IF: 1:50 - 1:200
Immunogen
Recombinant protein of human VPS36
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm, Endosome, Late endosome, Membrane, Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Related Product Information for anti-VPS36 antibody
This gene encodes a protein that is a subunit of the endosomal sorting complex required for transport II (ESCRT-II). This protein complex functions in sorting of ubiquitinated membrane proteins during endocytosis. A similar protein complex in rat is associated with RNA polymerase elongation factor II.
Product Categories/Family for anti-VPS36 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa/43kDa
NCBI Official Full Name
vacuolar protein-sorting-associated protein 36 isoform 3
NCBI Official Synonym Full Names
vacuolar protein sorting 36 homolog
NCBI Official Symbol
VPS36
NCBI Official Synonym Symbols
EAP45; C13orf9; CGI-145
NCBI Protein Information
vacuolar protein-sorting-associated protein 36
UniProt Protein Name
Vacuolar protein-sorting-associated protein 36
UniProt Gene Name
VPS36
UniProt Synonym Gene Names
C13orf9; EAP45

NCBI Description

This gene encodes a protein that is a subunit of the endosomal sorting complex required for transport II (ESCRT-II). This protein complex functions in sorting of ubiquitinated membrane proteins during endocytosis. A similar protein complex in rat is associated with RNA polymerase elongation factor II. [provided by RefSeq, Aug 2013]

Uniprot Description

Component of the ESCRT-II complex (endosomal sorting complex required for transport II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex. Its ability to bind ubiquitin probably plays a role in endosomal sorting of ubiquitinated cargo proteins by ESCRT complexes. The ESCRT-II complex may also play a role in transcription regulation, possibly via its interaction with ELL. Binds phosphoinosides such as PtdIns(3,4,5)P3.

Research Articles on VPS36

Similar Products

Product Notes

The VPS36 vps36 (Catalog #AAA9135143) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VPS36 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's VPS36 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF). IF: 1:50 - 1:200. Researchers should empirically determine the suitability of the VPS36 vps36 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EEQAAGIGKS AKIVVHLHPA PPNKEPGPFQ SSKNSYIKLS FKEHGQIEFY RRLSEEMTQR RWENMPVSQS LQTNRGPQPG RIRAVGIVGI ERKLEEKRKE TDKNISEAFE DLSKLMIKAK EMVELSKSIA NKIKDKQGDI TEDETIRFKS Y. It is sometimes possible for the material contained within the vial of "VPS36, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.