Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (VMD2L2 antibody (MBS5303296) used at 1.25 ug/ml to detect target protein.)

Rabbit anti-Human, Dog VMD2L2 Polyclonal Antibody | anti-VMD2L2 antibody

VMD2L2 antibody

Gene Names
BEST4; VMD2L2
Reactivity
Human, Dog
Applications
Western Blot
Purity
Total IgG Protein A purified
Synonyms
VMD2L2; Polyclonal Antibody; VMD2L2 antibody; Polyclonal VMD2L2; Anti-VMD2L2; VMDL 2; VMDL-2; Vitelliform Macular Dystrophy 2-like 2; anti-VMD2L2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Dog
Clonality
Polyclonal
Specificity
VMD2L2 antibody was raised against the N terminal Of Vmd2L2
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of VMD2L2 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
473
Applicable Applications for anti-VMD2L2 antibody
Western Blot (WB)
Application Notes
WB: 1.25 ug/ml
Biological Significance
VMD2L2 is 1 of 3 VMD2-like genes which encode transmembrane spanning proteins that share a homology region with a high content of aromatic residues including an invariant arginine (R), phenylalanine (F), and proline (P) motif.
Cross-Reactivity
Human,Dog
Immunogen
VMD2L2 antibody was raised using the N terminal Of Vmd2L2 corresponding to a region with amino acids MTVSYTLKVAEARFGGFSGLLLRWRGSIYKLLYKEFLLFGALYAVLSITY
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(VMD2L2 antibody (MBS5303296) used at 1.25 ug/ml to detect target protein.)

Western Blot (WB) (VMD2L2 antibody (MBS5303296) used at 1.25 ug/ml to detect target protein.)
Related Product Information for anti-VMD2L2 antibody
Rabbit polyclonal VMD2L2 antibody raised against the N terminal Of Vmd2L2
Product Categories/Family for anti-VMD2L2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
52 kDa (MW of target protein)
NCBI Official Full Name
vitelliform macular dystrophy 2-like 2
NCBI Official Synonym Full Names
bestrophin 4
NCBI Official Symbol
BEST4
NCBI Official Synonym Symbols
VMD2L2
NCBI Protein Information
bestrophin-4
UniProt Protein Name
Bestrophin-4
UniProt Gene Name
BEST4
UniProt Synonym Gene Names
VMD2L2
UniProt Entry Name
BEST4_HUMAN

NCBI Description

This gene is a member of the bestrophin gene family of anion channels. Bestrophin genes share a similar gene structure with highly conserved exon-intron boundaries, but with distinct 3' ends. Bestrophins are transmembrane proteins that contain a homologous region rich in aromatic residues, including an invariant arg-phe-pro motif. Mutation in one of the family members (bestrophin 1) is associated with vitelliform macular dystrophy. The bestrophin 4 gene is predominantly expressed in the colon. [provided by RefSeq, Jul 2008]

Uniprot Description

BEST4: Forms calcium-sensitive chloride channels. Permeable to bicarbonate. Belongs to the bestrophin family.

Protein type: Membrane protein, multi-pass; Transporter, ion channel; Membrane protein, integral; Transporter

Chromosomal Location of Human Ortholog: 1p34.1

Cellular Component: plasma membrane

Molecular Function: chloride channel activity

Research Articles on VMD2L2

Similar Products

Product Notes

The VMD2L2 best4 (Catalog #AAA5303296) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VMD2L2 antibody reacts with Human, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's VMD2L2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1.25 ug/ml. Researchers should empirically determine the suitability of the VMD2L2 best4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "VMD2L2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.