Western Blot (WB)
(Western Blot: Sample: Recombinant protein.)
Rabbit anti-Rat Vascular Endothelial Growth Factor Receptor 1 (VEGFR1) Polyclonal Antibody | anti-VEGFR1 antibody
Polyclonal Antibody to Vascular Endothelial Growth Factor Receptor 1 (VEGFR1)
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-SRDKGLYT CRVKSGSSFR TFNTSVHVYE KGFISVKHRK QQVQETIAGK RSHRLSMKVK AFPSPEVVWL KDGVPATEKS ARYSVHGYSL IIKDVTAEDA GDYTILLGIK QSKLFRNLTA TLIVNVKPQI YEKSVSSLPS PPLYPLGSRQ VLTCTVYGIP QPTIKWLWHP CHYNHSKERN DFCFGSEESF ILDSSSNIGN RIEGITQRMM VIEGTNKTVS TLVV
Immunocytochemistry in formalin fixed cells: 1:100-500
Immunohistochemistry in formalin fixed frozen section: 1:100-500
Immunohistochemistry in paraffin section: 1:50-200
Enzyme-linked Immunosorbent Assay: 1:100-200
Western Blot (WB)
(Western Blot: Sample: Recombinant protein.)
Western Blot (WB)
(Western Blot: Sample: Recombinant protein.)
Immunohistochemistry (IHC)
(DAB staining on fromalin fixed paraffin- embedded kidney tissue))
Immunohistochemistry (IHC)
(DAB staining on fromalin fixed paraffin- embedded kidney tissue))
Immunohistochemistry (IHC)
(DAB staining on IHC-P; Samples: Rat Kidney Tissue))
Immunohistochemistry (IHC)
(DAB staining on IHC-P; Samples: Rat Kidney Tissue))
NCBI and Uniprot Product Information
NCBI Description
tyrosine kinase receptor for vascular endothelial growth factor; may play a role in cell proliferation and cell survival [RGD, Feb 2006]
Uniprot Description
VEGFR1: a receptor tyrosine kinase of the VEGFR family. Receptor for VEGF, VEGFB and PGF. The VEGF-kinase ligand/receptor signaling system plays a key role in vascular development and regulation of vascular permeability. Two splice variant isoforms have been described. Isoform SFlt1 may have an inhibitory role in angiogenesis.
Protein type: EC 2.7.10.1; Kinase, protein; Membrane protein, integral; Protein kinase, TK; Protein kinase, tyrosine (receptor); TK group; VEGFR family
Chromosomal Location of Human Ortholog: 12p11
Cellular Component: actin cytoskeleton; endosome; extracellular space; focal adhesion; integral component of plasma membrane; nucleus; plasma membrane; receptor complex
Molecular Function: ATP binding; growth factor binding; identical protein binding; signal transducer, downstream of receptor, with protein tyrosine kinase activity; transmembrane receptor protein tyrosine kinase activity; vascular endothelial growth factor-activated receptor activity
Biological Process: activation of MAPKK activity; aging; angiogenesis; blood vessel morphogenesis; branching involved in blood vessel morphogenesis; cell migration; chemotaxis; embryonic morphogenesis; female pregnancy; intracellular receptor signaling pathway; monocyte chemotaxis; peptidyl-tyrosine phosphorylation; positive regulation of angiogenesis; positive regulation of cell migration; positive regulation of cell proliferation; positive regulation of fibroblast proliferation; positive regulation of MAP kinase activity; positive regulation of MAPK cascade; positive regulation of phosphatidylinositol 3-kinase activity; positive regulation of phosphoinositide 3-kinase cascade; positive regulation of smooth muscle cell proliferation; positive regulation of vascular endothelial growth factor receptor signaling pathway; post-embryonic camera-type eye morphogenesis; protein amino acid phosphorylation; protein autophosphorylation; regulation of smooth muscle contraction; response to activity; response to estradiol; response to ethanol; response to hypoxia; sprouting angiogenesis; transmembrane receptor protein tyrosine kinase signaling pathway; vascular endothelial growth factor receptor signaling pathway
Research Articles on VEGFR1
Similar Products
Product Notes
The VEGFR1 flt1 (Catalog #AAA2004693) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Polyclonal Antibody to Vascular Endothelial Growth Factor Receptor 1 (VEGFR1) reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Vascular Endothelial Growth Factor Receptor 1 (VEGFR1) can be used in a range of immunoassay formats including, but not limited to, Immunocytochemistry (ICC), Immunohistochemistry (IHC) - Formalin/Paraffin, ELISA (EIA), Western Blot (WB). Western blotting: 1:100-400 Immunocytochemistry in formalin fixed cells: 1:100-500 Immunohistochemistry in formalin fixed frozen section: 1:100-500 Immunohistochemistry in paraffin section: 1:50-200 Enzyme-linked Immunosorbent Assay: 1:100-200. Researchers should empirically determine the suitability of the VEGFR1 flt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-SRDKGLY T CRVKSGSSFR TFNTSVHVYE KGFISVKHRK QQVQETIAGK RSHRLSMKVK AFPSPEVVWL KDGVPATEKS ARYSVHGYSL IIKDVTAEDA GDYTILLGIK QSKLFRNLTA TLIVNVKPQI YEKSVSSLPS PPLYPLGSRQ VLTCTVYGIP QPTIKWLWHP CHYNHSKERN DFCFGSEESF ILDSSSNIGN RIEGITQRMM VIEGTNKTVS TLVV. It is sometimes possible for the material contained within the vial of "Vascular Endothelial Growth Factor Receptor 1 (VEGFR1), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
