Rabbit anti-Human USP6 Polyclonal Antibody | anti-USP6 antibody
USP6 Polyclonal Antibody
Gene Names
USP6; HRP1; TRE2; TRE17; Tre-2; TRESMCR; USP6-short
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
USP6; Polyclonal Antibody; USP6 Polyclonal Antibody; HRP1; Tre-2; TRE17; TRE2; TRESMCR; USP6-short; anti-USP6 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
ELPPVTAREAKKIRREMTRTSKWMEMLGEWETYKHSSKLIDRVYKGIPMNIRGPVWSVLLNIQEIK
Sequence Length
1406
Applicable Applications for anti-USP6 antibody
Western Blot (WB)
Application Notes
WB: 1:1000 - 1:2000
Immunogen
Recombinant protein of human USP6
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cell membrane, Cytoplasm, Endosome
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Product Categories/Family for anti-USP6 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
89kDa/121kDa/158kDa
NCBI Official Full Name
ubiquitin carboxyl-terminal hydrolase 6
NCBI Official Synonym Full Names
ubiquitin specific peptidase 6
NCBI Official Symbol
USP6
NCBI Official Synonym Symbols
HRP1; TRE2; TRE17; Tre-2; TRESMCR; USP6-short
NCBI Protein Information
ubiquitin carboxyl-terminal hydrolase 6
UniProt Protein Name
Ubiquitin carboxyl-terminal hydrolase 6
Protein Family
UniProt Gene Name
USP6
UniProt Synonym Gene Names
HRP1; TRE2
Uniprot Description
Deubiquitinase with an ATP-independent isopeptidase activity, cleaving at the C-terminus of the ubiquitin moiety. Catalyzes its own deubiquitination. In vitro, isoform 2, but not isoform 3, shows deubiquitinating activity. Promotes plasma membrane localization of ARF6 and selectively regulates ARF6-dependent endocytic protein trafficking. Is able to initiate tumorigenesis by inducing the production of matrix metalloproteinases following NF-kappa-B activation.
Research Articles on USP6
Similar Products
Product Notes
The USP6 usp6 (Catalog #AAA9133302) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The USP6 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's USP6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:1000 - 1:2000. Researchers should empirically determine the suitability of the USP6 usp6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ELPPVTAREA KKIRREMTRT SKWMEMLGEW ETYKHSSKLI DRVYKGIPMN IRGPVWSVLL NIQEIK. It is sometimes possible for the material contained within the vial of "USP6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
