Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-USP35 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

Rabbit USP35 Polyclonal Antibody | anti-USP35 antibody

USP35 antibody - C-terminal region

Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
USP35; Polyclonal Antibody; USP35 antibody - C-terminal region; anti-USP35 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MEAISKDNILYLQEQEKEARSRAAYISALPTSPHWGRGFDEDKDEDEGSP
Sequence Length
1018
Applicable Applications for anti-USP35 antibody
Western Blot (WB)
Homology
Cow: 83%; Dog: 100%; Goat: 100%; Horse: 82%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 82%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human USP35
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-USP35 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-USP35 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)
Related Product Information for anti-USP35 antibody
This is a rabbit polyclonal antibody against USP35. It was validated on Western Blot

Target Description: The function of USP35 remians unknown.
Product Categories/Family for anti-USP35 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
113kDa
NCBI Official Full Name
ubiquitin carboxyl-terminal hydrolase 35
NCBI Official Synonym Full Names
ubiquitin specific peptidase 35
NCBI Official Symbol
USP35
NCBI Protein Information
ubiquitin carboxyl-terminal hydrolase 35
UniProt Protein Name
Ubiquitin carboxyl-terminal hydrolase 35
UniProt Gene Name
USP35
UniProt Synonym Gene Names
KIAA1372; USP34
UniProt Entry Name
UBP35_HUMAN

NCBI Description

This gene encodes a member of the peptidase C19 family of ubiquitin-specific proteases. These deubiquitinating enzymes (DUBs) catalyze the removal of ubiquitin proteins from other proteins. The encoded protein associates with polarized mitochondria and has been shown to inhibit NF-kappa B activation and delay PARK2-mediated degradation of mitochondria. Expression of this gene is upregulated by the let-7a microRNA and reduced expression has been observed in human tumor tissues. [provided by RefSeq, Jul 2017]

Uniprot Description

USP35: Belongs to the peptidase C19 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Protease; EC 3.4.19.12; Ubiquitin conjugating system; Ubiquitin-specific protease

Chromosomal Location of Human Ortholog: 11q14.1

Molecular Function: cysteine-type endopeptidase activity; ubiquitin-specific protease activity

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; protein deubiquitination

Research Articles on USP35

Similar Products

Product Notes

The USP35 usp35 (Catalog #AAA3214287) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The USP35 antibody - C-terminal region reacts with Cow, Dog, Goat, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's USP35 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the USP35 usp35 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MEAISKDNIL YLQEQEKEAR SRAAYISALP TSPHWGRGFD EDKDEDEGSP. It is sometimes possible for the material contained within the vial of "USP35, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.