Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of DR4 expression in rat spleen extract (lane 1), mouse spleen extract (lane 2) and MCF-7 whole cell lysates (lane 3). DR4 at 50KD was detected using rabbit anti- DR4 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit DR4 Polyclonal Antibody | anti-TNFRSF10A antibody

Anti-DR4 Antibody

Gene Names
TNFRSF10A; DR4; APO2; CD261; TRAILR1; TRAILR-1
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
DR4; Polyclonal Antibody; Anti-DR4 Antibody; APO2; TRAILR1; CD261 antigen; TNFRSF10A; TR10A; TRAIL R1; TRAIL-R1; O00220; Tumor necrosis factor receptor superfamily member 10A; TNF receptor superfamily member 10a; anti-TNFRSF10A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
468
Applicable Applications for anti-TNFRSF10A antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5ug/ml
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human DR4 (99-131aa VLLQVVPSSAATIKLHDQSIGTQQWEHSPLGEL).
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of DR4 expression in rat spleen extract (lane 1), mouse spleen extract (lane 2) and MCF-7 whole cell lysates (lane 3). DR4 at 50KD was detected using rabbit anti- DR4 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of DR4 expression in rat spleen extract (lane 1), mouse spleen extract (lane 2) and MCF-7 whole cell lysates (lane 3). DR4 at 50KD was detected using rabbit anti- DR4 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-TNFRSF10A antibody
Rabbit IgG polyclonal antibody for Tumor necrosis factor receptor superfamily member 10A(TNFRSF10A) detection.
Background: TNFRSF10A (Tumor Necrosis Factor Receptor Subfamily Member 10A), also known as APO2, DR4 or TRAILR1, is a protein that in humans is encoded by the TNFRSF10A gene. The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL), and thus transduces cell death signal and induces cell apoptosis. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein.
References
1. Walczak H, Degli-Esposti MA, Johnson RS, Smolak PJ, Waugh JY, Boiani N, Timour MS, Gerhart MJ, Schooley KA, Smith CA, Goodwin RG, Rauch CT (Dec 1997). "TRAIL-R2: a novel apoptosis-mediating receptor for TRAIL". EMBO J. 16 (17): 5386-97.
2. Pan G, O'Rourke K,  Chinnaiyan AM, Gentz R, Ebner R, Ni J, Dixit VM (April 1997). "The receptor for the cytotoxic ligand TRAIL". Science. 276 (5309): 111-3.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,089 Da
NCBI Official Full Name
tumor necrosis factor receptor superfamily member 10A
NCBI Official Synonym Full Names
TNF receptor superfamily member 10a
NCBI Official Symbol
TNFRSF10A
NCBI Official Synonym Symbols
DR4; APO2; CD261; TRAILR1; TRAILR-1
NCBI Protein Information
tumor necrosis factor receptor superfamily member 10A
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 10A
UniProt Gene Name
TNFRSF10A
UniProt Synonym Gene Names
APO2; DR4; TRAILR1; TRAIL receptor 1; TRAIL-R1

NCBI Description

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL), and thus transduces cell death signal and induces cell apoptosis. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein. [provided by RefSeq, Jul 2008]

Uniprot Description

TRAIL-R1: Receptor for the cytotoxic ligand TNFSF10/TRAIL. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF- kappa-B.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 8p21.3

Cellular Component: cell surface; integral to membrane; integral to plasma membrane; plasma membrane

Molecular Function: death receptor activity; protease binding; protein binding; transcription factor binding; tumor necrosis factor receptor activity

Biological Process: caspase activation; cell surface receptor linked signal transduction; immune response; inflammatory response; multicellular organismal development; regulation of apoptosis; regulation of cell proliferation; response to lipopolysaccharide; signal transduction

Research Articles on TNFRSF10A

Similar Products

Product Notes

The TNFRSF10A tnfrsf10a (Catalog #AAA178662) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-DR4 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DR4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the TNFRSF10A tnfrsf10a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DR4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.