Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: UPK3ASample Tissue: Human PANC1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human UPK3A Polyclonal Antibody | anti-UPK3A antibody

UPK3A Antibody - N-terminal region

Gene Names
UPK3A; UP3A; UPK3; UPIII; UPIIIA
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
UPK3A; Polyclonal Antibody; UPK3A Antibody - N-terminal region; anti-UPK3A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ALGCLRFGSAVNLQPQLASVTFATNNPTLTTVALEKPLCMFDSKEALTGT
Sequence Length
287
Applicable Applications for anti-UPK3A antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human UPK3A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: UPK3ASample Tissue: Human PANC1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: UPK3ASample Tissue: Human PANC1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-UPK3A antibody
This gene encodes a member of the uroplakin family, a group of transmembrane proteins that form complexes on the apical surface of the bladder epithelium. Mutations in this gene may be associated with renal adysplasia. Alternatively spliced transcript variants have been described.
Product Categories/Family for anti-UPK3A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31 kDa
NCBI Official Full Name
uroplakin-3a isoform 2
NCBI Official Synonym Full Names
uroplakin 3A
NCBI Official Symbol
UPK3A
NCBI Official Synonym Symbols
UP3A; UPK3; UPIII; UPIIIA
NCBI Protein Information
uroplakin-3a
UniProt Protein Name
Uroplakin-3a
Protein Family
UniProt Gene Name
UPK3A
UniProt Synonym Gene Names
UPK3; UP3a; UPIII
UniProt Entry Name
UPK3A_HUMAN

NCBI Description

This gene encodes a member of the uroplakin family, a group of transmembrane proteins that form complexes on the apical surface of the bladder epithelium. Mutations in this gene may be associated with renal adysplasia. Alternatively spliced transcript variants have been described.[provided by RefSeq, Nov 2009]

Uniprot Description

UPK3A: Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in AUM-cytoskeleton interaction in terminally differentiated urothelial cells. It also contributes to the formation of urothelial glycocalyx which may play an important role in preventing bacterial adherence. Defects in UPK3A are a cause of renal adysplasia (RADYS); also known as renal agenesis or renal aplasia. Renal agenesis refers to the absence of one (unilateral) or both (bilateral) kidneys at birth. Bilateral renal agenesis belongs to a group of perinatally lethal renal diseases, including severe bilateral renal dysplasia, unilateral renal agenesis with contralateral dysplasia and severe obstructive uropathy. Belongs to the uroplakin-3 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 22q13.31

Cellular Component: endoplasmic reticulum membrane; apical plasma membrane; integral to membrane

Biological Process: epithelial cell differentiation; urinary bladder development; water transport; urea transport; cell morphogenesis; sodium ion homeostasis; kidney development; potassium ion homeostasis

Disease: Renal Hypodysplasia/aplasia 1

Research Articles on UPK3A

Similar Products

Product Notes

The UPK3A upk3a (Catalog #AAA3221330) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UPK3A Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UPK3A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UPK3A upk3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ALGCLRFGSA VNLQPQLASV TFATNNPTLT TVALEKPLCM FDSKEALTGT. It is sometimes possible for the material contained within the vial of "UPK3A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.