Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit UPF3A Polyclonal Antibody | anti-UPF3A antibody

UPF3A antibody

Gene Names
UPF3A; UPF3; HUPF3A; RENT3A
Applications
Western Blot
Purity
Affinity purified
Synonyms
UPF3A; Polyclonal Antibody; UPF3A antibody; Polyclonal UPF3A; Anti-UPF3A; RENT3A; UPFA-3; UPFA 3; UPF3; HUPF3A; Upf3 Regulator Of Nonsense Transcripts Homolog A; anti-UPF3A antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UPF3A antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
151
Applicable Applications for anti-UPF3A antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
UPF3A is part of a multiprotein post-splicing mRNP complex involved in both mRNA nuclear export and mRNA surveillance. UPF3A is involved in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons.
Cross-Reactivity
Human
Immunogen
UPF3A antibody was raised using a synthetic peptide corresponding to a region with amino acids QRYHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKKGSQDSGAPG
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-UPF3A antibody
Rabbit polyclonal UPF3A antibody
Product Categories/Family for anti-UPF3A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
55 kDa (MW of target protein)
NCBI Official Full Name
UPF3A protein
NCBI Official Synonym Full Names
UPF3 regulator of nonsense transcripts homolog A (yeast)
NCBI Official Symbol
UPF3A
NCBI Official Synonym Symbols
UPF3; HUPF3A; RENT3A
NCBI Protein Information
regulator of nonsense transcripts 3A
UniProt Protein Name
Regulator of nonsense transcripts 3A
UniProt Gene Name
UPF3A
UniProt Synonym Gene Names
RENT3A; UPF3; hUpf3
UniProt Entry Name
REN3A_HUMAN

NCBI Description

This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The encoded protein is one of two functional homologs to yeast Upf3p. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions. This gene is located on the long arm of chromosome 13. Two splice variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

UPF3A: Involved in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons by associating with the nuclear exon junction complex (EJC) and serving as link between the EJC core and NMD machinery. Recruits UPF2 at the cytoplasmic side of the nuclear envelope and the subsequent formation of an UPF1-UPF2- UPF3 surveillance complex (including UPF1 bound to release factors at the stalled ribosome) is believed to activate NMD. However, UPF3A is shown to be only marginally active in NMD as compared to UPF3B. Binds spliced mRNA upstream of exon-exon junctions. In vitro, weakly stimulates translation. Belongs to the RENT3 family. 3 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 13q34

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; cytoplasm; plasma membrane; cytosol; nucleus

Molecular Function: protein binding; RNA binding; nucleotide binding; nucleocytoplasmic transporter activity

Biological Process: mRNA transport; positive regulation of translation; mRNA catabolic process, nonsense-mediated decay; nucleocytoplasmic transport; gene expression

Research Articles on UPF3A

Similar Products

Product Notes

The UPF3A upf3a (Catalog #AAA5300566) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's UPF3A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the UPF3A upf3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UPF3A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.