Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GSTO2 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysate)

Rabbit GSTO2 Polyclonal Antibody | anti-GSTO2 antibody

GSTO2 antibody - middle region

Gene Names
GSTO2; GSTO 2-2; bA127L20.1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GSTO2; Polyclonal Antibody; GSTO2 antibody - middle region; anti-GSTO2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKV
Sequence Length
243
Applicable Applications for anti-GSTO2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%; Yeast: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle of human GSTO2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GSTO2 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysate)

Western Blot (WB) (WB Suggested Anti-GSTO2 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysate)
Related Product Information for anti-GSTO2 antibody
This is a rabbit polyclonal antibody against GSTO2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The omega class glutathione transferases (GST; EC 2.5.1.18) have poor activity with common GST substrates, but exhibit novel glutathione-dependent thioltransferase, dehydroascorbate reductase, and monomethylarsonate reductase activities, and they modulate Ca(2+) release by ryanodine receptors (e.g., RYR1).
Product Categories/Family for anti-GSTO2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
glutathione S-transferase omega-2 isoform 1
NCBI Official Synonym Full Names
glutathione S-transferase omega 2
NCBI Official Symbol
GSTO2
NCBI Official Synonym Symbols
GSTO 2-2; bA127L20.1
NCBI Protein Information
glutathione S-transferase omega-2
UniProt Protein Name
Glutathione S-transferase omega-2
Protein Family
UniProt Gene Name
GSTO2
UniProt Synonym Gene Names
GSTO-2; GSTO 2-2; MMA(V) reductase
UniProt Entry Name
GSTO2_HUMAN

NCBI Description

The protein encoded by this gene is an omega class glutathione S-transferase (GST). GSTs are involved in the metabolism of xenobiotics and carcinogens. Four transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jul 2010]

Uniprot Description

GSTO2: Exhibits glutathione-dependent thiol transferase activity. Has high dehydroascorbate reductase activity and may contribute to the recycling of ascorbic acid. Participates in the biotransformation of inorganic arsenic and reduces monomethylarsonic acid (MMA). Belongs to the GST superfamily. Omega family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Other Amino Acids Metabolism - glutathione; Xenobiotic Metabolism - drug metabolism - cytochrome P450; EC 1.20.4.2; Transferase; EC 2.5.1.18; EC 1.8.5.1; Xenobiotic Metabolism - metabolism by cytochrome P450

Chromosomal Location of Human Ortholog: 10q25.1

Cellular Component: cytosol

Molecular Function: glutathione transferase activity; glutathione dehydrogenase (ascorbate) activity; methylarsonate reductase activity; oxidoreductase activity

Biological Process: vitamin metabolic process; xenobiotic metabolic process; L-ascorbic acid metabolic process; water-soluble vitamin metabolic process

Research Articles on GSTO2

Similar Products

Product Notes

The GSTO2 gsto2 (Catalog #AAA3209354) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GSTO2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's GSTO2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GSTO2 gsto2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VLETSQCQLI YESVIACEYL DDAYPGRKLF PYDPYERARQ KMLLELFCKV. It is sometimes possible for the material contained within the vial of "GSTO2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.