Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of UNC119 expression in transfected 293T cell line by UNC119 polyclonal antibody. Lane 1: UNC119 transfected lysate (27kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human UNC119 Polyclonal Antibody | anti-unc119b antibody

UNC119 (Protein Unc-119 Homolog A, Retinal Protein 4, RG4, hRG4, POC7, POC7A)

Gene Names
unc119b; Unc119; unc119.2; zgc:136476
Reactivity
Human
Applications
Western Blot, Immunoprecipitation
Purity
Serum
Serum
Synonyms
UNC119; Polyclonal Antibody; UNC119 (Protein Unc-119 Homolog A; Retinal Protein 4; RG4; hRG4; POC7; POC7A); Anti -UNC119 (Protein Unc-119 Homolog A; anti-unc119b antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human UNC119.
Purity/Purification
Serum
Serum
Form/Format
Supplied as a liquid.
Sequence
MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP
Applicable Applications for anti-unc119b antibody
Western Blot (WB), Immunoprecipitation (IP)
Application Notes
Suitable for use in Immunoprecipitation and Western Blot.
Immunogen
Full length human UNC119, aa1-240 (NP_005139.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of UNC119 expression in transfected 293T cell line by UNC119 polyclonal antibody. Lane 1: UNC119 transfected lysate (27kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of UNC119 expression in transfected 293T cell line by UNC119 polyclonal antibody. Lane 1: UNC119 transfected lysate (27kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(mmunoprecipitation of UNC119 transfected lysate using UNC119 rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with UNC119 mouse polyclonal antibody)

Immunoprecipitation (IP) (mmunoprecipitation of UNC119 transfected lysate using UNC119 rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with UNC119 mouse polyclonal antibody)
Product Categories/Family for anti-unc119b antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
unc-119 homolog b isoform 1
NCBI Official Synonym Full Names
unc-119 homolog b (C. elegans)
NCBI Official Symbol
unc119b
NCBI Official Synonym Symbols
Unc119; unc119.2; zgc:136476
NCBI Protein Information
unc-119 homolog b; unc-119 homolog 2; unc-119-like protein 2
Protein Family

Similar Products

Product Notes

The unc119b (Catalog #AAA6013632) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UNC119 (Protein Unc-119 Homolog A, Retinal Protein 4, RG4, hRG4, POC7, POC7A) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UNC119 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunoprecipitation (IP). Suitable for use in Immunoprecipitation and Western Blot. Researchers should empirically determine the suitability of the unc119b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MKVKKGGGGA GTATESAPGP SGQSVAPIPQ PPAESESGSE SEPDAGPGPR PGPLQRKQPI GPEDVLGLQR ITGDYLCSPE ENIYKIDFVR FKIRDMDSGT VLFEIKKPPV SERLPINRRD LDPNAGRFVR YQFTPAFLRL RQVGATVEFT VGDKPVNNFR MIERHYFRNQ LLKSFDFHFG FCIPSSKNTC EHIYDFPPLS EELISEMIRH PYETQSDSFY FVDDRLVMHN KADYSYSGTP. It is sometimes possible for the material contained within the vial of "UNC119, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.