Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (52.51kD).)

Mouse anti-Human UNC119 Monoclonal Antibody | anti-UNC119 antibody

UNC119 (Protein Unc-119 Homolog A, Retinal Protein 4, RG4, hRG4, POC7, POC7A) (Biotin)

Gene Names
UNC119; HRG4; POC7; IMD13; POC7A
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
UNC119; Monoclonal Antibody; UNC119 (Protein Unc-119 Homolog A; Retinal Protein 4; RG4; hRG4; POC7; POC7A) (Biotin); anti-UNC119 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2F9-2A9
Specificity
Recognizes human UNC119.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-UNC119 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-241 from UNC119 (AAH27176) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (52.51kD).)

Western Blot (WB) (Western Blot detection against Immunogen (52.51kD).)

Western Blot (WB)

(Western Blot analysis of UNC119 expression in transfected 293T cell line by UNC119 monoclonal antibody Lane 1: UNC119 transfected lysate (27kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of UNC119 expression in transfected 293T cell line by UNC119 monoclonal antibody Lane 1: UNC119 transfected lysate (27kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-UNC119 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
24,112 Da
NCBI Official Full Name
Homo sapiens unc-119 homolog (C. elegans), mRNA
NCBI Official Synonym Full Names
unc-119 lipid binding chaperone
NCBI Official Symbol
UNC119
NCBI Official Synonym Symbols
HRG4; POC7; IMD13; POC7A
NCBI Protein Information
protein unc-119 homolog A
Protein Family

NCBI Description

This gene is specifically expressed in the photoreceptors in the retina. The encoded product shares strong homology with the C. elegans unc119 protein and it can functionally complement the C. elegans unc119 mutation. It has been localized to the photoreceptor synapses in the outer plexiform layer of the retina, and suggested to play a role in the mechanism of photoreceptor neurotransmitter release through the synaptic vesicle cycle. Two transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]

Research Articles on UNC119

Similar Products

Product Notes

The UNC119 (Catalog #AAA6145072) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UNC119 (Protein Unc-119 Homolog A, Retinal Protein 4, RG4, hRG4, POC7, POC7A) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UNC119 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UNC119 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UNC119, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.