Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Mouse, Rat Uhrf2 Polyclonal Antibody | anti-Uhrf2 antibody

Uhrf2 Polyclonal Antibody

Gene Names
Uhrf2; Nirf; AI426270; AW214556; 2310065A22Rik; D130071B19Rik
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
Uhrf2; Polyclonal Antibody; Uhrf2 Polyclonal Antibody; NIRF; RNF107; TDRD23; URF2; anti-Uhrf2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
DSSLPSTSKQNDAQVKPSSHNPPKVKKTARGGSSSQPSTSARTCLIDPGFGLYKVNELVDARDVGLGAWFEAHIHSVTRASDGHSRGKTPLKNGSSYKRTNGNVNHNSKENTNKLDNVPSTSNSDSVAADEDVIYHIEYDEYPESGILEMNVKDLRPRARTILKWNELNVGDVVMVNYNVENPGKRGFWYDAEITTLKTISRTKKEVRVKVFLGGSEGTLNDCRVMSVDEIFKIEKPGAHPISFADGKFLRKNDP
Sequence Length
346
Applicable Applications for anti-Uhrf2 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of mouse Uhrf2
Immunogen Species
Mouse
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Related Product Information for anti-Uhrf2 antibody
This gene encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. The encoded protein contains an NIRF_N domain, a PHD finger, a set- and ring-associated (SRA) domain, and a RING finger domain and several of these domains have been shown to be essential for the regulation of cell proliferation. This protein may also have a role in intranuclear degradation of polyglutamine aggregates. Alternative splicing results in multiple transcript variants some of which are non-protein coding.
Product Categories/Family for anti-Uhrf2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
24kDa/57kDa/90kDa
NCBI Official Full Name
UHRF2, partial
NCBI Official Synonym Full Names
ubiquitin-like, containing PHD and RING finger domains 2
NCBI Official Symbol
Uhrf2
NCBI Official Synonym Symbols
Nirf; AI426270; AW214556; 2310065A22Rik; D130071B19Rik
NCBI Protein Information
E3 ubiquitin-protein ligase UHRF2
UniProt Protein Name
E3 ubiquitin-protein ligase UHRF2
UniProt Gene Name
Uhrf2
UniProt Synonym Gene Names
Nirf

Uniprot Description

E3 SUMO-, but not ubiquitin-, protein ligase for ZNF131 (). E3 ubiquitin-protein ligase that is an intermolecular hub protein in the cell cycle network. Ubiquitinates cyclins, CCND1 and CCNE1, in an apparently phosphorylation-independent manner and induces G1 arrest. Also ubiquitinates PCNP leading to its degradation by the proteasome. Through cooperative DNA and histone binding, may contribute to a tighter epigenetic control of gene expression in differentiated cells.

Research Articles on Uhrf2

Similar Products

Product Notes

The Uhrf2 uhrf2 (Catalog #AAA9133678) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Uhrf2 Polyclonal Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Uhrf2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the Uhrf2 uhrf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DSSLPSTSKQ NDAQVKPSSH NPPKVKKTAR GGSSSQPSTS ARTCLIDPGF GLYKVNELVD ARDVGLGAWF EAHIHSVTRA SDGHSRGKTP LKNGSSYKRT NGNVNHNSKE NTNKLDNVPS TSNSDSVAAD EDVIYHIEYD EYPESGILEM NVKDLRPRAR TILKWNELNV GDVVMVNYNV ENPGKRGFWY DAEITTLKTI SRTKKEVRVK VFLGGSEGTL NDCRVMSVDE IFKIEKPGAH PISFADGKFL RKNDP. It is sometimes possible for the material contained within the vial of "Uhrf2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.