Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-UGDH AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole CellUGDH is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit UGDH Polyclonal Antibody | anti-UGDH antibody

UGDH antibody - C-terminal region

Gene Names
UGDH; GDH; UGD; UDPGDH; UDP-GlcDH
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
UGDH; Polyclonal Antibody; UGDH antibody - C-terminal region; anti-UGDH antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VLDGLHNELQTIGFQIETIGKKVSSKRIPYAPSGEIPKFSLQDPPNKKPK
Sequence Length
494
Applicable Applications for anti-UGDH antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-UGDH AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole CellUGDH is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-UGDH AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole CellUGDH is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-UGDH antibody
This is a rabbit polyclonal antibody against UGDH. It was validated on Western Blot

Target Description: The protein encoded by this gene converts UDP-glucose to UDP-glucuronate and thereby participates in the biosynthesis of glycosaminoglycans such as hyaluronan, chondroitin sulfate, and heparan sulfate. These glycosylated compounds are common components of the extracellular matrix and likely play roles in signal transduction, cell migration, and cancer growth and metastasis. The expression of this gene is up-regulated by transforming growth factor beta and down-regulated by hypoxia.
Product Categories/Family for anti-UGDH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
UDP-glucose 6-dehydrogenase isoform 1
NCBI Official Synonym Full Names
UDP-glucose 6-dehydrogenase
NCBI Official Symbol
UGDH
NCBI Official Synonym Symbols
GDH; UGD; UDPGDH; UDP-GlcDH
NCBI Protein Information
UDP-glucose 6-dehydrogenase
UniProt Protein Name
UDP-glucose 6-dehydrogenase
UniProt Gene Name
UGDH
UniProt Synonym Gene Names
UDP-Glc dehydrogenase; UDP-GlcDH; UDPGDH
UniProt Entry Name
UGDH_HUMAN

NCBI Description

The protein encoded by this gene converts UDP-glucose to UDP-glucuronate and thereby participates in the biosynthesis of glycosaminoglycans such as hyaluronan, chondroitin sulfate, and heparan sulfate. These glycosylated compounds are common components of the extracellular matrix and likely play roles in signal transduction, cell migration, and cancer growth and metastasis. The expression of this gene is up-regulated by transforming growth factor beta and down-regulated by hypoxia. Alternative splicing results in multiple transcript variants.[provided by RefSeq, May 2010]

Uniprot Description

UGDH: Involved in the biosynthesis of glycosaminoglycans; hyaluronan, chondroitin sulfate, and heparan sulfate. Belongs to the UDP-glucose/GDP-mannose dehydrogenase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 1.1.1.22; Carbohydrate Metabolism - starch and sucrose; Carbohydrate Metabolism - amino sugar and nucleotide sugar; Motility/polarity/chemotaxis; Oxidoreductase; Carbohydrate Metabolism - pentose and glucuronate interconversions; Carbohydrate Metabolism - ascorbate and aldarate

Chromosomal Location of Human Ortholog: 4p15.1

Cellular Component: nucleoplasm; cytosol

Molecular Function: electron carrier activity; NAD binding; UDP-glucose 6-dehydrogenase activity

Biological Process: glycosaminoglycan biosynthetic process; xenobiotic metabolic process; gastrulation with mouth forming second; UDP-glucuronate biosynthetic process; UDP-glucose metabolic process

Research Articles on UGDH

Similar Products

Product Notes

The UGDH ugdh (Catalog #AAA3215145) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UGDH antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's UGDH can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UGDH ugdh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VLDGLHNELQ TIGFQIETIG KKVSSKRIPY APSGEIPKFS LQDPPNKKPK. It is sometimes possible for the material contained within the vial of "UGDH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.