Rabbit anti-Mouse UCP1 Polyclonal Antibody | anti-UCP1 antibody

UCP1 Antibody - middle region

Cat. Num. AAA3223601

• Gene Names: Ucp1; Ucp; Slc25a7; AI385626
• Reactivity: Mouse
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: UCP1; Polyclonal Antibody; UCP1 Antibody - middle region; anti-UCP1 antibody

• Host: Rabbit
• Reactivity: Mouse
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: RMQAQSHLHGIKPRYTGTYNAYRVIATTESLSTLWKGTTPNLMRNVIINC
• Sequence Length: 307

• Applicable Applications for anti-UCP1 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse UCP1
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: UCP1Sample Tissue: Mouse Heart lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-UCP1 antibody

Mitochondrial protein responsible for thermogenic respiration, a specialized capacity of brown adipose tissue and beige fat that participates to non-shivering adaptive thermogenesis to temperature and diet variations and more generally to the regulation of energy balance. Functions as a long-chain fatty acid/LCFA and proton symporter, simultaneously transporting one LCFA and one proton through the inner mitochondrial membrane. However, LCFAs remaining associated with the transporter via their hydrophobic tails, it results in an apparent transport of protons activated by LCFAs. Thereby, dissipates the mitochondrial proton gradient and converts the energy of substrate oxydation into heat instead of ATP. Regulates the production of reactive oxygen species/ROS by mitochondria.

Product Categories/Family for anti-UCP1 antibody

Polyclonal; Signaling Intermediate; Mitochondria; Membrane & Traffic

NCBI and Uniprot Product Information

• NCBI GI #: 6678497
• NCBI GeneID: 22227
• NCBI Accession #: NP_033489.1
• NCBI GenBank Nucleotide #: NM_009463.3
• UniProt Accession #: P12242
• Molecular Weight: 33 kDa
• NCBI Official Full Name: mitochondrial brown fat uncoupling protein 1
• NCBI Official Synonym Full Names: uncoupling protein 1 (mitochondrial, proton carrier)
• NCBI Official Symbol: Ucp1
• NCBI Official Synonym Symbols: Ucp; Slc25a7; AI385626
• NCBI Protein Information: mitochondrial brown fat uncoupling protein 1
• UniProt Protein Name: Mitochondrial brown fat uncoupling protein 1
• Protein Family: Mitochondrial brown fat uncoupling protein
• UniProt Gene Name: Ucp1
• UniProt Synonym Gene Names: UCP 1Curated

Uniprot Description

Mitochondrial protein responsible for thermogenic respiration, a specialized capacity of brown adipose tissue and beige fat that participates to non-shivering adaptive thermogenesis to temperature and diet variations and more generally to the regulation of energy balance (PubMed:9139827, PubMed:19187776, PubMed:23063128, PubMed:27027295). Functions as a long-chain fatty acid/LCFA and proton symporter, simultaneously transporting one LCFA and one proton through the inner mitochondrial membrane. However, LCFAs remaining associated with the transporter via their hydrophobic tails, it results in an apparent transport of protons activated by LCFAs. Thereby, dissipates the mitochondrial proton gradient and converts the energy of substrate oxydation into heat instead of ATP (PubMed:23063128). Regulates the production of reactive oxygen species/ROS by mitochondria (PubMed:20416274, PubMed:20466728).