Western Blot (WB)
(Host: RabbitTarget Name: UCN3Sample Tissue: Human DLD1 Whole CellAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human UCN3 Polyclonal Antibody | anti-UCN3 antibody
UCN3 Antibody - middle region
Gene Names
UCN3; SCP; SPC; UCNIII
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
UCN3; Polyclonal Antibody; UCN3 Antibody - middle region; anti-UCN3 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SQAQPRGKPRQDTAKSPHRTKFTLSLDVPTNIMNLLFNIAKAKNLRAQAA
Sequence Length
161
Applicable Applications for anti-UCN3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human UCN3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: UCN3Sample Tissue: Human DLD1 Whole CellAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: UCN3Sample Tissue: Human DLD1 Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-UCN3 antibody
This gene is a member of the sauvagine/corticotropin-releasing factor/urotensin I family. It is structurally related to the corticotropin-releasing factor (CRF) gene and the encoded product is an endogenous ligand for CRF type 2 receptors. In the brain it may be responsible for the effects of stress on appetite. In spite of the gene family name similarity, the product of this gene has no sequence similarity to urotensin II.
Product Categories/Family for anti-UCN3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18 kDa
NCBI Official Full Name
urocortin-3 preproprotein
NCBI Official Synonym Full Names
urocortin 3
NCBI Official Symbol
UCN3
NCBI Official Synonym Symbols
SCP; SPC; UCNIII
NCBI Protein Information
urocortin-3
UniProt Protein Name
Urocortin-3
Protein Family
UniProt Gene Name
UCN3
UniProt Synonym Gene Names
SPC; Ucn III
NCBI Description
This gene encodes a member of the sauvagine/corticotropin-releasing factor/urotensin I family of proteins. The encoded preproprotein is proteolytically processed to generate the mature peptide hormone, which is secreted by pancreatic beta and alpha cells. This hormone is an endogenous ligand for corticotropin-releasing factor receptor 2 and may regulate insulin secretion in response to plasma glucose levels. Patients with type 2 diabetes exhibit reduced levels of the encoded protein in beta cells. In the brain, the encoded protein may be responsible for the effects of stress on appetite. [provided by RefSeq, May 2016]
Uniprot Description
Suppresses food intake, delays gastric emptying and decreases heat-induced edema. Might represent an endogenous ligand for maintaining homeostasis after stress.
Research Articles on UCN3
Similar Products
Product Notes
The UCN3 ucn3 (Catalog #AAA3220825) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UCN3 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UCN3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UCN3 ucn3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SQAQPRGKPR QDTAKSPHRT KFTLSLDVPT NIMNLLFNIA KAKNLRAQAA. It is sometimes possible for the material contained within the vial of "UCN3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
