Mouse anti-Human UBE2Z Polyclonal Antibody | anti-UBE2Z antibody

UBE2Z (Ubiquitin-conjugating Enzyme E2 Z, HOYS7, Uba6-specific E2 Conjugating Enzyme 1, Use1, Ubiquitin Carrier Protein Z, Ubiquitin-protein Ligase Z)

Cat. Num. AAA648720

• Gene Names: UBE2Z; USE1; HOYS7
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: UBE2Z; Polyclonal Antibody; UBE2Z (Ubiquitin-conjugating Enzyme E2 Z; HOYS7; Uba6-specific E2 Conjugating Enzyme 1; Use1; Ubiquitin Carrier Protein Z; Ubiquitin-protein Ligase Z); Anti -UBE2Z (Ubiquitin-conjugating Enzyme E2 Z; anti-UBE2Z antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human UBE2Z.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MSIYKEPPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV

• Applicable Applications for anti-UBE2Z antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human UBE2Z, aa1-246 (NP_075567.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of UBE2Z expression in transfected 293T cell line by UBE2Z polyclonal antibody. Lane 1: UBE2Z transfected lysate (27.06kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-UBE2Z antibody

Antibodies; Abs to Ubiquitin

NCBI and Uniprot Product Information

• NCBI GI #: 150417999
• NCBI GeneID: 65264
• NCBI Accession #: NP_075567.2
• NCBI GenBank Nucleotide #: NM_023079.4
• UniProt Accession #: Q9H832; Q7L354; Q8TCM4; Q9H893; A6N8M6; A6NC60
• Molecular Weight: 38,210 Da
• NCBI Official Full Name: ubiquitin-conjugating enzyme E2 Z
• NCBI Official Synonym Full Names: ubiquitin-conjugating enzyme E2Z
• NCBI Official Symbol: UBE2Z
• NCBI Official Synonym Symbols: USE1; HOYS7
• NCBI Protein Information: ubiquitin-conjugating enzyme E2 Z; UBA6-specific enzyme E2; ubiquitin-protein ligase Z; ubiquitin carrier protein Z; uba6-specific E2 conjugating enzyme 1
• UniProt Protein Name: Ubiquitin-conjugating enzyme E2 Z
• Protein Family: Ubiquitin-conjugating enzyme
• UniProt Gene Name: UBE2Z
• UniProt Synonym Gene Names: Use1
• UniProt Entry Name: UBE2Z_HUMAN

NCBI Description

This gene encodes an enzyme which ubiquitinates proteins which participate in signaling pathways and apoptosis. [provided by RefSeq, Feb 2012]

Uniprot Description

Function: Catalyzes the covalent attachment of ubiquitin to other proteins

By similarity. Specific substrate for UBA6, not charged with ubiquitin by UBE1. May be involved in apoptosis regulation. Ref.1 Ref.10

Catalytic activity: ATP + ubiquitin + protein lysine = AMP + diphosphate + protein N-ubiquityllysine.

Pathway: Protein modification; protein ubiquitination.

Subcellular location: Cytoplasm. Nucleus Ref.9.

Tissue specificity: Widely expressed. Highly in placenta, pancreas, spleen and testis. Ref.1 Ref.9

Sequence similarities: Belongs to the ubiquitin-conjugating enzyme family.

Sequence caution: The sequence AAH15890.1 differs from that shown. Reason: Erroneous initiation. The sequence BAB14724.1 differs from that shown. Reason: Erroneous initiation.