Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of UBE2T expression in transfected 293T cell line by UBE2T polyclonal antibody. Lane 1: UBE2T transfected lysate (22.5kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human UBE2T Polyclonal Antibody | anti-UBE2T antibody

UBE2T (Ubiquitin-conjugating Enzyme E2 T, Cell Proliferation-inducing Gene 50 Protein, HSPC150, PIG50, Ubiquitin Carrier Protein T, Ubiquitin-protein Ligase T) APC

Gene Names
UBE2T; FANCT; PIG50; HSPC150
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
UBE2T; Polyclonal Antibody; UBE2T (Ubiquitin-conjugating Enzyme E2 T; Cell Proliferation-inducing Gene 50 Protein; HSPC150; PIG50; Ubiquitin Carrier Protein T; Ubiquitin-protein Ligase T) APC; EC=6.3.2.19; anti-UBE2T antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human UBE2T.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
928
Applicable Applications for anti-UBE2T antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human UBE2T, aa1-197 (NP_054895.1).
Immunogen Sequence
MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of UBE2T expression in transfected 293T cell line by UBE2T polyclonal antibody. Lane 1: UBE2T transfected lysate (22.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of UBE2T expression in transfected 293T cell line by UBE2T polyclonal antibody. Lane 1: UBE2T transfected lysate (22.5kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-UBE2T antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
Homo sapiens ubiquitin-conjugating enzyme E2T (putative) (UBE2T), mRNA
NCBI Official Synonym Full Names
ubiquitin conjugating enzyme E2 T
NCBI Official Symbol
UBE2T
NCBI Official Synonym Symbols
FANCT; PIG50; HSPC150
NCBI Protein Information
ubiquitin-conjugating enzyme E2 T

NCBI Description

The protein encoded by this gene catalyzes the covalent attachment of ubiquitin to protein substrates. Defects in this gene have been associated with Fanconi anemia of complementation group T. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2015]

Research Articles on UBE2T

Similar Products

Product Notes

The UBE2T (Catalog #AAA6397876) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UBE2T (Ubiquitin-conjugating Enzyme E2 T, Cell Proliferation-inducing Gene 50 Protein, HSPC150, PIG50, Ubiquitin Carrier Protein T, Ubiquitin-protein Ligase T) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UBE2T can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UBE2T for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UBE2T, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.