Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: UBE2CSample Tissue: NCI-H226 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human UBE2C Polyclonal Antibody | anti-UBE2C antibody

UBE2C Antibody - middle region

Gene Names
UBE2C; UBCH10; dJ447F3.2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
UBE2C; Polyclonal Antibody; UBE2C Antibody - middle region; anti-UBE2C antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 16% sucrose.
Sequence
Synthetic peptide located within the following region: SAFPESDNLFKWVGTIHGAAGTAVGSIRTSSTVCLLSGPRETQDSSKPLV
Sequence Length
161
Applicable Applications for anti-UBE2C antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human UBE2C
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: UBE2CSample Tissue: NCI-H226 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: UBE2CSample Tissue: NCI-H226 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-UBE2C antibody
ubiquitin-conjugating enzyme E2C

Target Description: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, ubiquitin-conjugating enzymes, and ubiquitin-protein ligases. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is required for the destruction of mitotic cyclins and for cell cycle progression, and may be involved in cancer progression. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been defined on chromosomes 4, 14, 15, 18, and 19.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17 kDa
NCBI Official Full Name
ubiquitin-conjugating enzyme E2 C isoform 2
NCBI Official Synonym Full Names
ubiquitin conjugating enzyme E2 C
NCBI Official Symbol
UBE2C
NCBI Official Synonym Symbols
UBCH10; dJ447F3.2
NCBI Protein Information
ubiquitin-conjugating enzyme E2 C
UniProt Protein Name
Ubiquitin-conjugating enzyme E2 C
UniProt Gene Name
UBE2C
UniProt Synonym Gene Names
UBCH10
UniProt Entry Name
UBE2C_HUMAN

NCBI Description

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, ubiquitin-conjugating enzymes, and ubiquitin-protein ligases. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is required for the destruction of mitotic cyclins and for cell cycle progression, and may be involved in cancer progression. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been defined on chromosomes 4, 14, 15, 18, and 19. [provided by RefSeq, Aug 2013]

Uniprot Description

UBE2C: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys- 11'- and 'Lys-48'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by initiating 'Lys-11'-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by the proteasome and promoting mitotic exit. Belongs to the ubiquitin-conjugating enzyme family.

Protein type: Ubiquitin conjugating system; Ligase; Cell cycle regulation; EC 6.3.2.19; Ubiquitin ligase

Chromosomal Location of Human Ortholog: 20q13.12

Cellular Component: nucleoplasm; anaphase-promoting complex; cytoplasm; cytosol

Molecular Function: protein binding; small conjugating protein ligase activity; ubiquitin protein ligase binding; ubiquitin-protein ligase activity; ATP binding; ligase activity

Biological Process: ubiquitin-dependent protein catabolic process; positive regulation of ubiquitin-protein ligase activity during mitotic cell cycle; negative regulation of ubiquitin-protein ligase activity during mitotic cell cycle; regulation of mitotic metaphase/anaphase transition; protein ubiquitination; cyclin catabolic process; regulation of ubiquitin-protein ligase activity during mitotic cell cycle; anaphase-promoting complex activation; cell division; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; mitotic cell cycle spindle assembly checkpoint; mitotic cell cycle; exit from mitosis; positive regulation of exit from mitosis

Research Articles on UBE2C

Similar Products

Product Notes

The UBE2C ube2c (Catalog #AAA3206889) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UBE2C Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UBE2C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UBE2C ube2c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SAFPESDNLF KWVGTIHGAA GTAVGSIRTS STVCLLSGPR ETQDSSKPLV. It is sometimes possible for the material contained within the vial of "UBE2C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.