Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: UBBSample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human UBB Polyclonal Antibody | anti-UBB antibody

UBB Antibody - C-terminal region

Gene Names
UBB; HEL-S-50
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
UBB; Polyclonal Antibody; UBB Antibody - C-terminal region; anti-UBB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE
Sequence Length
229
Applicable Applications for anti-UBB antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human UBB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: UBBSample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: UBBSample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-UBB antibody
This gene encodes ubiquitin, one of the most conserved proteins known. Ubiquitin has a major role in targeting cellular proteins for degradation by the 26S proteosome. It is also involved in the maintenance of chromatin structure, the regulation of gene expression, and the stress response. Ubiquitin is synthesized as a precursor protein consisting of either polyubiquitin chains or a single ubiquitin moiety fused to an unrelated protein. This gene consists of three direct repeats of the ubiquitin coding sequence with no spacer sequence. Consequently, the protein is expressed as a polyubiquitin precursor with a final amino acid after the last repeat. An aberrant form of this protein has been detected in patients with Alzheimer's disease and Down syndrome. Pseudogenes of this gene are located on chromosomes 1, 2, 13, and 17. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-UBB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26 kDa
NCBI Official Full Name
polyubiquitin-B
NCBI Official Synonym Full Names
ubiquitin B
NCBI Official Symbol
UBB
NCBI Official Synonym Symbols
HEL-S-50
NCBI Protein Information
polyubiquitin-B
UniProt Protein Name
Polyubiquitin-B
Protein Family
UniProt Gene Name
UBB
UniProt Entry Name
UBB_HUMAN

NCBI Description

This gene encodes ubiquitin, one of the most conserved proteins known. Ubiquitin has a major role in targeting cellular proteins for degradation by the 26S proteosome. It is also involved in the maintenance of chromatin structure, the regulation of gene expression, and the stress response. Ubiquitin is synthesized as a precursor protein consisting of either polyubiquitin chains or a single ubiquitin moiety fused to an unrelated protein. This gene consists of three direct repeats of the ubiquitin coding sequence with no spacer sequence. Consequently, the protein is expressed as a polyubiquitin precursor with a final amino acid after the last repeat. An aberrant form of this protein has been detected in patients with Alzheimer's disease and Down syndrome. Pseudogenes of this gene are located on chromosomes 1, 2, 13, and 17. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]

Uniprot Description

UBB: Ubiquitin exists either covalently attached to another protein, or free (unanchored). When covalently bound, it is conjugated to target proteins via an isopeptide bond either as a monomer (monoubiquitin), a polymer linked via different Lys residues of the ubiquitin (polyubiquitin chains) or a linear polymer linked via the initiator Met of the ubiquitin (linear polyubiquitin chains). Polyubiquitin chains, when attached to a target protein, have different functions depending on the Lys residue of the ubiquitin that is linked: Lys-6-linked may be involved in DNA repair; Lys-11-linked is involved in ERAD (endoplasmic reticulum-associated degradation) and in cell-cycle regulation; Lys-29-linked is involved in lysosomal degradation; Lys-33-linked is involved in kinase modification; Lys-48-linked is involved in protein degradation via the proteasome; Lys-63-linked is involved in endocytosis, DNA-damage responses as well as in signaling processes leading to activation of the transcription factor NF-kappa-B. Linear polymer chains formed via attachment by the initiator Met lead to cell signaling. Ubiquitin is usually conjugated to Lys residues of target proteins, however, in rare cases, conjugation to Cys or Ser residues has been observed. When polyubiquitin is free (unanchored-polyubiquitin), it also has distinct roles, such as in activation of protein kinases, and in signaling. Belongs to the ubiquitin family.

Protein type: Apoptosis; Ubiquitin-like modifier; Cell development/differentiation; Cell cycle regulation; Transcription regulation; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 17p12-p11.2

Cellular Component: nucleoplasm; neuron projection; cell soma; mitochondrion; plasma membrane; endosome membrane; cytosol

Molecular Function: protein binding

Biological Process: circadian rhythm; I-kappaB kinase/NF-kappaB cascade; negative regulation of ubiquitin-protein ligase activity during mitotic cell cycle; protein polyubiquitination; nerve growth factor receptor signaling pathway; viral reproduction; positive regulation of apoptosis; activation of MAPK activity; stress-activated MAPK cascade; toll-like receptor 3 signaling pathway; endosome transport; T cell receptor signaling pathway; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; activation of NF-kappaB transcription factor; mitochondrion transport along microtubule; regulation of apoptosis; toll-like receptor 5 signaling pathway; antigen processing and presentation of peptide antigen via MHC class I; regulation of mitochondrial membrane potential; transforming growth factor beta receptor signaling pathway; JNK cascade; antigen processing and presentation of exogenous peptide antigen via MHC class I; G2/M transition of mitotic cell cycle; toll-like receptor 4 signaling pathway; regulation of interferon type I production; glycogen biosynthetic process; fibroblast growth factor receptor signaling pathway; positive regulation of I-kappaB kinase/NF-kappaB cascade; transcription, DNA-dependent; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; glucose metabolic process; Notch receptor processing; virus assembly; toll-like receptor 2 signaling pathway; carbohydrate metabolic process; viral protein processing; positive regulation of transcription from RNA polymerase II promoter; toll-like receptor 9 signaling pathway; negative regulation of interferon type I production; negative regulation of apoptosis; G1/S transition of mitotic cell cycle; positive regulation of ubiquitin-protein ligase activity during mitotic cell cycle; negative regulation of epidermal growth factor receptor signaling pathway; apoptosis; pathogenesis; negative regulation of transcription from RNA polymerase II promoter; viral infectious cycle; toll-like receptor 10 signaling pathway; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; positive regulation of interferon type I production; transmembrane transport; epidermal growth factor receptor signaling pathway; transcription initiation from RNA polymerase II promoter; Notch signaling pathway; cytokine and chemokine mediated signaling pathway; MyD88-independent toll-like receptor signaling pathway; DNA repair; MyD88-dependent toll-like receptor signaling pathway; regulation of ubiquitin-protein ligase activity during mitotic cell cycle; toll-like receptor signaling pathway; innate immune response; gene expression; mitotic cell cycle; negative regulation of transforming growth factor beta receptor signaling pathway; neurite morphogenesis

Disease: Cleft Palate, Isolated

Research Articles on UBB

Similar Products

Product Notes

The UBB ubb (Catalog #AAA3222404) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UBB Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UBB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UBB ubb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LIFAGKQLED GRTLSDYNIQ KESTLHLVLR LRGGMQIFVK TLTGKTITLE. It is sometimes possible for the material contained within the vial of "UBB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.