Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-UACA AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)

Rabbit UACA Polyclonal Antibody | anti-UACA antibody

UACA antibody - C-terminal region

Gene Names
UACA; NUCLING
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
UACA; Polyclonal Antibody; UACA antibody - C-terminal region; anti-UACA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TELLNDVERLKQALNGLSQLTYTSGNPTKRQSQLIDTLQHQVKSLEQQLA
Sequence Length
1403
Applicable Applications for anti-UACA antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 85%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 85%; Rabbit: 92%; Rat: 85%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-UACA AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)

Western Blot (WB) (WB Suggested Anti-UACA AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)
Related Product Information for anti-UACA antibody
This is a rabbit polyclonal antibody against UACA. It was validated on Western Blot

Target Description: UACA regulates APAF1 expression and plays an important role in the regulation of stress-induced apoptosis. It promotes apoptosis by regulating three pathways, apoptosome up-regulation, LGALS3/galectin-3 down-regulation and NF-kappa-B inactivation. It regulates the redistribution of APAF1 into the nucleus after proapoptotic stress and down-regulates the expression of LGALS3 by inhibiting NFKB1.
Product Categories/Family for anti-UACA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
154kDa
NCBI Official Full Name
uveal autoantigen with coiled-coil domains and ankyrin repeats isoform 2
NCBI Official Synonym Full Names
uveal autoantigen with coiled-coil domains and ankyrin repeats
NCBI Official Symbol
UACA
NCBI Official Synonym Symbols
NUCLING
NCBI Protein Information
uveal autoantigen with coiled-coil domains and ankyrin repeats
UniProt Protein Name
Uveal autoantigen with coiled-coil domains and ankyrin repeats
UniProt Gene Name
UACA
UniProt Synonym Gene Names
KIAA1561
UniProt Entry Name
UACA_HUMAN

NCBI Description

This gene encodes a protein that contains ankyrin repeats and coiled coil domains and likely plays a role in apoptosis. Studies in rodents have implicated the encoded protein in the stimulation of apoptosis and the regulation of mammary gland involution, in which the mammary gland returns to its pre-pregnant state. This protein has also been proposed to negatively regulate apoptosis based on experiments in human cell lines in which the protein was shown to interact with PRKC apoptosis WT1 regulator protein, also known as PAR-4, and inhibit translocation of the PAR-4 receptor. Autoantibodies to this protein have been identified in human patients with panuveitis and Graves' disease. Differential expression of this gene has been observed in various human cancers. [provided by RefSeq, May 2017]

Research Articles on UACA

Similar Products

Product Notes

The UACA uaca (Catalog #AAA3215474) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UACA antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's UACA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UACA uaca for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TELLNDVERL KQALNGLSQL TYTSGNPTKR QSQLIDTLQH QVKSLEQQLA. It is sometimes possible for the material contained within the vial of "UACA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.